KEGG   Physeter catodon (sperm whale): 102975958
Entry
102975958         CDS       T06011                                 

Gene name
CDC42
Definition
(RefSeq) cell division control protein 42 homolog isoform X1
  KO
K04393  cell division control protein 42
Organism
pcad  Physeter catodon (sperm whale)
Pathway
pcad04010  MAPK signaling pathway
pcad04014  Ras signaling pathway
pcad04015  Rap1 signaling pathway
pcad04062  Chemokine signaling pathway
pcad04144  Endocytosis
pcad04360  Axon guidance
pcad04370  VEGF signaling pathway
pcad04510  Focal adhesion
pcad04520  Adherens junction
pcad04530  Tight junction
pcad04660  T cell receptor signaling pathway
pcad04666  Fc gamma R-mediated phagocytosis
pcad04670  Leukocyte transendothelial migration
pcad04722  Neurotrophin signaling pathway
pcad04810  Regulation of actin cytoskeleton
pcad04912  GnRH signaling pathway
pcad04932  Non-alcoholic fatty liver disease
pcad04933  AGE-RAGE signaling pathway in diabetic complications
pcad05100  Bacterial invasion of epithelial cells
pcad05132  Salmonella infection
pcad05135  Yersinia infection
pcad05165  Human papillomavirus infection
pcad05200  Pathways in cancer
pcad05203  Viral carcinogenesis
pcad05205  Proteoglycans in cancer
pcad05211  Renal cell carcinoma
pcad05212  Pancreatic cancer
Brite
KEGG Orthology (KO) [BR:pcad00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04010 MAPK signaling pathway
    102975958 (CDC42)
   04014 Ras signaling pathway
    102975958 (CDC42)
   04015 Rap1 signaling pathway
    102975958 (CDC42)
   04370 VEGF signaling pathway
    102975958 (CDC42)
 09140 Cellular Processes
  09141 Transport and catabolism
   04144 Endocytosis
    102975958 (CDC42)
  09144 Cellular community - eukaryotes
   04510 Focal adhesion
    102975958 (CDC42)
   04520 Adherens junction
    102975958 (CDC42)
   04530 Tight junction
    102975958 (CDC42)
  09142 Cell motility
   04810 Regulation of actin cytoskeleton
    102975958 (CDC42)
 09150 Organismal Systems
  09151 Immune system
   04660 T cell receptor signaling pathway
    102975958 (CDC42)
   04666 Fc gamma R-mediated phagocytosis
    102975958 (CDC42)
   04670 Leukocyte transendothelial migration
    102975958 (CDC42)
   04062 Chemokine signaling pathway
    102975958 (CDC42)
  09152 Endocrine system
   04912 GnRH signaling pathway
    102975958 (CDC42)
  09156 Nervous system
   04722 Neurotrophin signaling pathway
    102975958 (CDC42)
  09158 Development and regeneration
   04360 Axon guidance
    102975958 (CDC42)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    102975958 (CDC42)
   05205 Proteoglycans in cancer
    102975958 (CDC42)
   05203 Viral carcinogenesis
    102975958 (CDC42)
  09162 Cancer: specific types
   05212 Pancreatic cancer
    102975958 (CDC42)
   05211 Renal cell carcinoma
    102975958 (CDC42)
  09167 Endocrine and metabolic disease
   04932 Non-alcoholic fatty liver disease
    102975958 (CDC42)
   04933 AGE-RAGE signaling pathway in diabetic complications
    102975958 (CDC42)
  09171 Infectious disease: bacterial
   05132 Salmonella infection
    102975958 (CDC42)
   05135 Yersinia infection
    102975958 (CDC42)
   05100 Bacterial invasion of epithelial cells
    102975958 (CDC42)
  09172 Infectious disease: viral
   05165 Human papillomavirus infection
    102975958 (CDC42)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04131 Membrane trafficking [BR:pcad04131]
    102975958 (CDC42)
   03036 Chromosome and associated proteins [BR:pcad03036]
    102975958 (CDC42)
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:pcad04147]
    102975958 (CDC42)
   04031 GTP-binding proteins [BR:pcad04031]
    102975958 (CDC42)
Membrane trafficking [BR:pcad04131]
 Exocytosis
  Small GTPases and associated proteins
   Rho GTPases
    102975958 (CDC42)
 Endocytosis
  Lipid raft mediated endocytosis
   GRAF1-dependent endocytosis
    102975958 (CDC42)
  Macropinocytosis
   Ras GTPases
    102975958 (CDC42)
Chromosome and associated proteins [BR:pcad03036]
 Eukaryotic type
  Centrosome formation and ciliogenesis proteins
   Other centriole associated proteins
    102975958 (CDC42)
Exosome [BR:pcad04147]
 Exosomal proteins
  Exosomal proteins of microglial cells
   102975958 (CDC42)
  Exosomal proteins of breast milk
   102975958 (CDC42)
GTP-binding proteins [BR:pcad04031]
 Small (monomeric) G-proteins
  Rho Family
   Rac/Cdc42 [OT]
    102975958 (CDC42)
SSDB
Motif
Pfam: Ras Roc Arf PET117 GTP_EFTU
Other DBs
NCBI-GeneID: 102975958
NCBI-ProteinID: XP_023981123
UniProt: A0A2Y9SZ98
LinkDB
Position
3
AA seq 191 aa
MQTIKCVVVGDGAVGKTCLLISYTTNKFPSEYVPTVFDNYAVTVMIGGEPYTLGLFDTAG
QEDYDRLRPLSYPQTDVFLVCFSVVSPSSFENVKEKWVPEITHHCPKTPFLLVGTQIDLR
DDPSTIEKLAKNKQKPITPETAEKLARDLKAVKYVECSALTQKGLKNVFDEAILAALEPP
EPKKSRRCVLL
NT seq 576 nt   +upstreamnt  +downstreamnt
atgcagacaattaagtgcgttgttgtgggcgatggtgccgttggtaaaacatgtctcctg
atatcctacacaacaaacaaatttccatctgagtatgtaccgactgtttttgacaactat
gcagtcacagttatgattggtggagagccttatactcttggactttttgatactgcaggg
caagaggattatgacagattacgaccgctgagttatccacaaacagatgtatttctagtc
tgtttttcagtggtctctccatcctcattcgaaaatgtgaaagaaaagtgggtgcctgag
ataactcaccactgtccaaagactcctttcttgcttgttgggacccagattgatctcaga
gatgacccctctactattgagaaacttgccaagaataaacagaagcctatcaccccagag
actgctgaaaaactggcccgtgacctgaaggctgtcaagtatgtggagtgttctgcactt
acacagaaaggcctaaagaatgtatttgacgaagcaatattggctgccctggagcctcca
gaaccgaagaagagccgcaggtgtgtgctgctatga

KEGG   Physeter catodon (sperm whale): 102979195
Entry
102979195         CDS       T06011                                 

Definition
(RefSeq) rho-related BTB domain-containing protein 2
  KO
K04392  Ras-related C3 botulinum toxin substrate 1
Organism
pcad  Physeter catodon (sperm whale)
Pathway
pcad04010  MAPK signaling pathway
pcad04014  Ras signaling pathway
pcad04015  Rap1 signaling pathway
pcad04024  cAMP signaling pathway
pcad04062  Chemokine signaling pathway
pcad04071  Sphingolipid signaling pathway
pcad04145  Phagosome
pcad04151  PI3K-Akt signaling pathway
pcad04310  Wnt signaling pathway
pcad04360  Axon guidance
pcad04370  VEGF signaling pathway
pcad04380  Osteoclast differentiation
pcad04510  Focal adhesion
pcad04520  Adherens junction
pcad04530  Tight junction
pcad04613  Neutrophil extracellular trap formation
pcad04620  Toll-like receptor signaling pathway
pcad04650  Natural killer cell mediated cytotoxicity
pcad04662  B cell receptor signaling pathway
pcad04664  Fc epsilon RI signaling pathway
pcad04666  Fc gamma R-mediated phagocytosis
pcad04670  Leukocyte transendothelial migration
pcad04722  Neurotrophin signaling pathway
pcad04810  Regulation of actin cytoskeleton
pcad04932  Non-alcoholic fatty liver disease
pcad04933  AGE-RAGE signaling pathway in diabetic complications
pcad04972  Pancreatic secretion
pcad05014  Amyotrophic lateral sclerosis
pcad05020  Prion disease
pcad05022  Pathways of neurodegeneration - multiple diseases
pcad05100  Bacterial invasion of epithelial cells
pcad05132  Salmonella infection
pcad05135  Yersinia infection
pcad05163  Human cytomegalovirus infection
pcad05167  Kaposi sarcoma-associated herpesvirus infection
pcad05169  Epstein-Barr virus infection
pcad05170  Human immunodeficiency virus 1 infection
pcad05200  Pathways in cancer
pcad05203  Viral carcinogenesis
pcad05205  Proteoglycans in cancer
pcad05210  Colorectal cancer
pcad05211  Renal cell carcinoma
pcad05212  Pancreatic cancer
pcad05231  Choline metabolism in cancer
pcad05416  Viral myocarditis
pcad05418  Fluid shear stress and atherosclerosis
Brite
KEGG Orthology (KO) [BR:pcad00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04010 MAPK signaling pathway
    102979195
   04014 Ras signaling pathway
    102979195
   04015 Rap1 signaling pathway
    102979195
   04310 Wnt signaling pathway
    102979195
   04370 VEGF signaling pathway
    102979195
   04071 Sphingolipid signaling pathway
    102979195
   04024 cAMP signaling pathway
    102979195
   04151 PI3K-Akt signaling pathway
    102979195
 09140 Cellular Processes
  09141 Transport and catabolism
   04145 Phagosome
    102979195
  09144 Cellular community - eukaryotes
   04510 Focal adhesion
    102979195
   04520 Adherens junction
    102979195
   04530 Tight junction
    102979195
  09142 Cell motility
   04810 Regulation of actin cytoskeleton
    102979195
 09150 Organismal Systems
  09151 Immune system
   04613 Neutrophil extracellular trap formation
    102979195
   04620 Toll-like receptor signaling pathway
    102979195
   04650 Natural killer cell mediated cytotoxicity
    102979195
   04662 B cell receptor signaling pathway
    102979195
   04664 Fc epsilon RI signaling pathway
    102979195
   04666 Fc gamma R-mediated phagocytosis
    102979195
   04670 Leukocyte transendothelial migration
    102979195
   04062 Chemokine signaling pathway
    102979195
  09154 Digestive system
   04972 Pancreatic secretion
    102979195
  09156 Nervous system
   04722 Neurotrophin signaling pathway
    102979195
  09158 Development and regeneration
   04360 Axon guidance
    102979195
   04380 Osteoclast differentiation
    102979195
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    102979195
   05205 Proteoglycans in cancer
    102979195
   05203 Viral carcinogenesis
    102979195
   05231 Choline metabolism in cancer
    102979195
  09162 Cancer: specific types
   05210 Colorectal cancer
    102979195
   05212 Pancreatic cancer
    102979195
   05211 Renal cell carcinoma
    102979195
  09164 Neurodegenerative disease
   05014 Amyotrophic lateral sclerosis
    102979195
   05020 Prion disease
    102979195
   05022 Pathways of neurodegeneration - multiple diseases
    102979195
  09166 Cardiovascular disease
   05418 Fluid shear stress and atherosclerosis
    102979195
   05416 Viral myocarditis
    102979195
  09167 Endocrine and metabolic disease
   04932 Non-alcoholic fatty liver disease
    102979195
   04933 AGE-RAGE signaling pathway in diabetic complications
    102979195
  09171 Infectious disease: bacterial
   05132 Salmonella infection
    102979195
   05135 Yersinia infection
    102979195
   05100 Bacterial invasion of epithelial cells
    102979195
  09172 Infectious disease: viral
   05170 Human immunodeficiency virus 1 infection
    102979195
   05163 Human cytomegalovirus infection
    102979195
   05167 Kaposi sarcoma-associated herpesvirus infection
    102979195
   05169 Epstein-Barr virus infection
    102979195
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04131 Membrane trafficking [BR:pcad04131]
    102979195
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:pcad04147]
    102979195
   04031 GTP-binding proteins [BR:pcad04031]
    102979195
Membrane trafficking [BR:pcad04131]
 Exocytosis
  Small GTPases and associated proteins
   Rho GTPases
    102979195
 Endocytosis
  Lipid raft mediated endocytosis
   Arf6-dependent endocytosis
    102979195
  Macropinocytosis
   Ras GTPases
    102979195
 Others
  NADPH oxidases (Nox) and associated proteins
   Nox associated proteins
    102979195
Exosome [BR:pcad04147]
 Exosomal proteins
  Exosomal proteins of haemopoietic cells  (B-cell, T-cell, DC-cell, reticulocyte, and mast cell)
   102979195
  Exosomal proteins of other body fluids (saliva and urine)
   102979195
  Exosomal proteins of colorectal cancer cells
   102979195
  Exosomal proteins of bladder cancer cells
   102979195
GTP-binding proteins [BR:pcad04031]
 Small (monomeric) G-proteins
  Rho Family
   Rac/Cdc42 [OT]
    102979195
SSDB
Motif
Pfam: Ras Roc
Other DBs
NCBI-GeneID: 102979195
NCBI-ProteinID: XP_028342314
UniProt: A0A455B1B7
LinkDB
Position
Unknown
AA seq 124 aa
MDSDMDYERPNVETIKCVVVGDNAVGKTRLICARACNATLTQYQLLATHVPTVWAIDQYR
VCQEVLERSRDVVDDVSVSLRLWDTFGDHHKDRRFAYGRSDVVVLCFSIANPNSLHHVKT
MWYP
NT seq 372 nt   +upstreamnt  +downstreamnt
atggattctgacatggattatgaaaggccaaacgtagagaccatcaagtgcgtggtagtg
ggggacaacgctgtgggcaagaccaggctcatctgtgcccgggcctgcaatgccaccctc
acccagtaccagctgctcgccacccatgtgcccacagtttgggccatcgaccagtaccgg
gtgtgtcaggaggtgctggaacgttcccgagacgtggtagatgatgtcagcgtgtccctc
cgtctctgggacacttttggagatcaccacaaagaccgtcgctttgcttatgggagatcc
gatgtggtggttctgtgcttctccatcgccaaccccaactccctccaccatgtcaagacc
atgtggtaccca

KEGG   Physeter catodon (sperm whale): 102990276
Entry
102990276         CDS       T06011                                 

Gene name
RAC1
Definition
(RefSeq) ras-related C3 botulinum toxin substrate 1
  KO
K04392  Ras-related C3 botulinum toxin substrate 1
Organism
pcad  Physeter catodon (sperm whale)
Pathway
pcad04010  MAPK signaling pathway
pcad04014  Ras signaling pathway
pcad04015  Rap1 signaling pathway
pcad04024  cAMP signaling pathway
pcad04062  Chemokine signaling pathway
pcad04071  Sphingolipid signaling pathway
pcad04145  Phagosome
pcad04151  PI3K-Akt signaling pathway
pcad04310  Wnt signaling pathway
pcad04360  Axon guidance
pcad04370  VEGF signaling pathway
pcad04380  Osteoclast differentiation
pcad04510  Focal adhesion
pcad04520  Adherens junction
pcad04530  Tight junction
pcad04613  Neutrophil extracellular trap formation
pcad04620  Toll-like receptor signaling pathway
pcad04650  Natural killer cell mediated cytotoxicity
pcad04662  B cell receptor signaling pathway
pcad04664  Fc epsilon RI signaling pathway
pcad04666  Fc gamma R-mediated phagocytosis
pcad04670  Leukocyte transendothelial migration
pcad04722  Neurotrophin signaling pathway
pcad04810  Regulation of actin cytoskeleton
pcad04932  Non-alcoholic fatty liver disease
pcad04933  AGE-RAGE signaling pathway in diabetic complications
pcad04972  Pancreatic secretion
pcad05014  Amyotrophic lateral sclerosis
pcad05020  Prion disease
pcad05022  Pathways of neurodegeneration - multiple diseases
pcad05100  Bacterial invasion of epithelial cells
pcad05132  Salmonella infection
pcad05135  Yersinia infection
pcad05163  Human cytomegalovirus infection
pcad05167  Kaposi sarcoma-associated herpesvirus infection
pcad05169  Epstein-Barr virus infection
pcad05170  Human immunodeficiency virus 1 infection
pcad05200  Pathways in cancer
pcad05203  Viral carcinogenesis
pcad05205  Proteoglycans in cancer
pcad05210  Colorectal cancer
pcad05211  Renal cell carcinoma
pcad05212  Pancreatic cancer
pcad05231  Choline metabolism in cancer
pcad05416  Viral myocarditis
pcad05418  Fluid shear stress and atherosclerosis
Brite
KEGG Orthology (KO) [BR:pcad00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04010 MAPK signaling pathway
    102990276 (RAC1)
   04014 Ras signaling pathway
    102990276 (RAC1)
   04015 Rap1 signaling pathway
    102990276 (RAC1)
   04310 Wnt signaling pathway
    102990276 (RAC1)
   04370 VEGF signaling pathway
    102990276 (RAC1)
   04071 Sphingolipid signaling pathway
    102990276 (RAC1)
   04024 cAMP signaling pathway
    102990276 (RAC1)
   04151 PI3K-Akt signaling pathway
    102990276 (RAC1)
 09140 Cellular Processes
  09141 Transport and catabolism
   04145 Phagosome
    102990276 (RAC1)
  09144 Cellular community - eukaryotes
   04510 Focal adhesion
    102990276 (RAC1)
   04520 Adherens junction
    102990276 (RAC1)
   04530 Tight junction
    102990276 (RAC1)
  09142 Cell motility
   04810 Regulation of actin cytoskeleton
    102990276 (RAC1)
 09150 Organismal Systems
  09151 Immune system
   04613 Neutrophil extracellular trap formation
    102990276 (RAC1)
   04620 Toll-like receptor signaling pathway
    102990276 (RAC1)
   04650 Natural killer cell mediated cytotoxicity
    102990276 (RAC1)
   04662 B cell receptor signaling pathway
    102990276 (RAC1)
   04664 Fc epsilon RI signaling pathway
    102990276 (RAC1)
   04666 Fc gamma R-mediated phagocytosis
    102990276 (RAC1)
   04670 Leukocyte transendothelial migration
    102990276 (RAC1)
   04062 Chemokine signaling pathway
    102990276 (RAC1)
  09154 Digestive system
   04972 Pancreatic secretion
    102990276 (RAC1)
  09156 Nervous system
   04722 Neurotrophin signaling pathway
    102990276 (RAC1)
  09158 Development and regeneration
   04360 Axon guidance
    102990276 (RAC1)
   04380 Osteoclast differentiation
    102990276 (RAC1)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    102990276 (RAC1)
   05205 Proteoglycans in cancer
    102990276 (RAC1)
   05203 Viral carcinogenesis
    102990276 (RAC1)
   05231 Choline metabolism in cancer
    102990276 (RAC1)
  09162 Cancer: specific types
   05210 Colorectal cancer
    102990276 (RAC1)
   05212 Pancreatic cancer
    102990276 (RAC1)
   05211 Renal cell carcinoma
    102990276 (RAC1)
  09164 Neurodegenerative disease
   05014 Amyotrophic lateral sclerosis
    102990276 (RAC1)
   05020 Prion disease
    102990276 (RAC1)
   05022 Pathways of neurodegeneration - multiple diseases
    102990276 (RAC1)
  09166 Cardiovascular disease
   05418 Fluid shear stress and atherosclerosis
    102990276 (RAC1)
   05416 Viral myocarditis
    102990276 (RAC1)
  09167 Endocrine and metabolic disease
   04932 Non-alcoholic fatty liver disease
    102990276 (RAC1)
   04933 AGE-RAGE signaling pathway in diabetic complications
    102990276 (RAC1)
  09171 Infectious disease: bacterial
   05132 Salmonella infection
    102990276 (RAC1)
   05135 Yersinia infection
    102990276 (RAC1)
   05100 Bacterial invasion of epithelial cells
    102990276 (RAC1)
  09172 Infectious disease: viral
   05170 Human immunodeficiency virus 1 infection
    102990276 (RAC1)
   05163 Human cytomegalovirus infection
    102990276 (RAC1)
   05167 Kaposi sarcoma-associated herpesvirus infection
    102990276 (RAC1)
   05169 Epstein-Barr virus infection
    102990276 (RAC1)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04131 Membrane trafficking [BR:pcad04131]
    102990276 (RAC1)
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:pcad04147]
    102990276 (RAC1)
   04031 GTP-binding proteins [BR:pcad04031]
    102990276 (RAC1)
Membrane trafficking [BR:pcad04131]
 Exocytosis
  Small GTPases and associated proteins
   Rho GTPases
    102990276 (RAC1)
 Endocytosis
  Lipid raft mediated endocytosis
   Arf6-dependent endocytosis
    102990276 (RAC1)
  Macropinocytosis
   Ras GTPases
    102990276 (RAC1)
 Others
  NADPH oxidases (Nox) and associated proteins
   Nox associated proteins
    102990276 (RAC1)
Exosome [BR:pcad04147]
 Exosomal proteins
  Exosomal proteins of haemopoietic cells  (B-cell, T-cell, DC-cell, reticulocyte, and mast cell)
   102990276 (RAC1)
  Exosomal proteins of other body fluids (saliva and urine)
   102990276 (RAC1)
  Exosomal proteins of colorectal cancer cells
   102990276 (RAC1)
  Exosomal proteins of bladder cancer cells
   102990276 (RAC1)
GTP-binding proteins [BR:pcad04031]
 Small (monomeric) G-proteins
  Rho Family
   Rac/Cdc42 [OT]
    102990276 (RAC1)
SSDB
Motif
Pfam: Ras Roc Arf CagD
Other DBs
NCBI-GeneID: 102990276
NCBI-ProteinID: XP_023976059
UniProt: A0A2Y9SJX5
LinkDB
Position
14
AA seq 192 aa
MQAIKCVVVGDGAVGKTCLLISYTTNAFPGEYIPTVFDNYSANVMVDGKPVNLGLWDTAG
QEDYDRLRPLSYPQTDVFLICFSLVSPASFENVRAKWYPEVRHHCPNTPIILVGTKLDLR
DDKDTIEKLKEKKLTPITYPQGLAMAKEIGAVKYLECSALTQRGLKTVFDEAIRAVLCPP
PVKKRKRKCLLL
NT seq 579 nt   +upstreamnt  +downstreamnt
atgcaggccatcaagtgtgtggtggtgggagacggagctgtaggtaaaacttgcctcctg
atcagttatacgaccaatgcctttcctggagagtatatccctactgtctttgacaactat
tctgccaatgtcatggtggatggaaaaccggtgaatctgggcttgtgggatacagctgga
caagaagattatgaccgattacgtcccctatcctatccgcaaacggatgtattcttgatt
tgcttttctcttgtgagtcctgcatcatttgaaaatgttcgtgcaaagtggtaccctgaa
gtgcgacaccactgtcccaacactcctatcatcctggtggggacgaaacttgatctgagg
gatgataaagacacgattgagaaactgaaggagaagaagctgacacccatcacctaccca
cagggcttggccatggccaaggagatcggtgccgtcaaatacctggaatgctcggcgctc
acgcagcgaggtctcaagacggtgtttgatgaagctatccgggcggttctctgcccaccc
cccgtcaagaagaggaagagaaaatgcctgctgttgtga

KEGG   Physeter catodon (sperm whale): 102990552
Entry
102990552         CDS       T06011                                 

Gene name
RAC2
Definition
(RefSeq) ras-related C3 botulinum toxin substrate 2 isoform X1
  KO
K07860  Ras-related C3 botulinum toxin substrate 2
Organism
pcad  Physeter catodon (sperm whale)
Pathway
pcad04010  MAPK signaling pathway
pcad04014  Ras signaling pathway
pcad04015  Rap1 signaling pathway
pcad04024  cAMP signaling pathway
pcad04062  Chemokine signaling pathway
pcad04071  Sphingolipid signaling pathway
pcad04310  Wnt signaling pathway
pcad04360  Axon guidance
pcad04370  VEGF signaling pathway
pcad04510  Focal adhesion
pcad04520  Adherens junction
pcad04613  Neutrophil extracellular trap formation
pcad04650  Natural killer cell mediated cytotoxicity
pcad04662  B cell receptor signaling pathway
pcad04664  Fc epsilon RI signaling pathway
pcad04666  Fc gamma R-mediated phagocytosis
pcad04670  Leukocyte transendothelial migration
pcad04810  Regulation of actin cytoskeleton
pcad05020  Prion disease
pcad05135  Yersinia infection
pcad05163  Human cytomegalovirus infection
pcad05170  Human immunodeficiency virus 1 infection
pcad05200  Pathways in cancer
pcad05210  Colorectal cancer
pcad05212  Pancreatic cancer
pcad05231  Choline metabolism in cancer
pcad05416  Viral myocarditis
pcad05418  Fluid shear stress and atherosclerosis
Brite
KEGG Orthology (KO) [BR:pcad00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04010 MAPK signaling pathway
    102990552 (RAC2)
   04014 Ras signaling pathway
    102990552 (RAC2)
   04015 Rap1 signaling pathway
    102990552 (RAC2)
   04310 Wnt signaling pathway
    102990552 (RAC2)
   04370 VEGF signaling pathway
    102990552 (RAC2)
   04071 Sphingolipid signaling pathway
    102990552 (RAC2)
   04024 cAMP signaling pathway
    102990552 (RAC2)
 09140 Cellular Processes
  09144 Cellular community - eukaryotes
   04510 Focal adhesion
    102990552 (RAC2)
   04520 Adherens junction
    102990552 (RAC2)
  09142 Cell motility
   04810 Regulation of actin cytoskeleton
    102990552 (RAC2)
 09150 Organismal Systems
  09151 Immune system
   04613 Neutrophil extracellular trap formation
    102990552 (RAC2)
   04650 Natural killer cell mediated cytotoxicity
    102990552 (RAC2)
   04662 B cell receptor signaling pathway
    102990552 (RAC2)
   04664 Fc epsilon RI signaling pathway
    102990552 (RAC2)
   04666 Fc gamma R-mediated phagocytosis
    102990552 (RAC2)
   04670 Leukocyte transendothelial migration
    102990552 (RAC2)
   04062 Chemokine signaling pathway
    102990552 (RAC2)
  09158 Development and regeneration
   04360 Axon guidance
    102990552 (RAC2)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    102990552 (RAC2)
   05231 Choline metabolism in cancer
    102990552 (RAC2)
  09162 Cancer: specific types
   05210 Colorectal cancer
    102990552 (RAC2)
   05212 Pancreatic cancer
    102990552 (RAC2)
  09164 Neurodegenerative disease
   05020 Prion disease
    102990552 (RAC2)
  09166 Cardiovascular disease
   05418 Fluid shear stress and atherosclerosis
    102990552 (RAC2)
   05416 Viral myocarditis
    102990552 (RAC2)
  09171 Infectious disease: bacterial
   05135 Yersinia infection
    102990552 (RAC2)
  09172 Infectious disease: viral
   05170 Human immunodeficiency virus 1 infection
    102990552 (RAC2)
   05163 Human cytomegalovirus infection
    102990552 (RAC2)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04031 GTP-binding proteins [BR:pcad04031]
    102990552 (RAC2)
GTP-binding proteins [BR:pcad04031]
 Small (monomeric) G-proteins
  Rho Family
   Rac/Cdc42 [OT]
    102990552 (RAC2)
SSDB
Motif
Pfam: Ras Roc Arf
Other DBs
NCBI-GeneID: 102990552
NCBI-ProteinID: XP_007111821
UniProt: A0A2Y9F0X9
LinkDB
Position
6
AA seq 192 aa
MQAIKCVVVGDGAVGKTCLLISYTTNAFPGEYIPTVFDNYSANVMVDSKPVNLGLWDTAG
QEDYDRLRPLSYPQTDVFLICFSLVSPASYENVRAKWFPEVRHHCPSTPIILVGTKLDLR
DDKDTIEKLKEKKLAPITYPQGLALAKEIDSVKYLECSALTQRGLKTVFDEAIRAVLCPQ
PTRPQKRPCSIL
NT seq 579 nt   +upstreamnt  +downstreamnt
atgcaggccataaagtgtgtggtggtgggagatggagccgtgggcaagacctgcctcctc
atcagctataccaccaacgccttcccgggagagtacatccccaccgtgtttgacaactat
tcagccaacgtgatggtggacagcaagcccgtgaacctggggctgtgggatacggcgggg
caggaggactacgaccgcctccggccgctctcctacccgcagacggacgtcttcctcatc
tgcttctcccttgtcagcccagcctcctatgagaatgtccgggccaagtggttcccggag
gtgcggcatcactgccccagcacgcccatcatcctggtgggcaccaagctggacttgcgg
gacgacaaggacaccatcgagaagctgaaggagaagaagctggcgcctattacttacccg
cagggactggcgctggccaaggagatcgactcagtgaaatacctggagtgctcggccctc
acccagagaggcctgaaaaccgtctttgacgaggcgatccgggctgtcctgtgcccccag
cccacgcggccacagaagcggccctgcagcatcctctag

KEGG   Physeter catodon (sperm whale): 102992553
Entry
102992553         CDS       T06011                                 

Gene name
RAC3
Definition
(RefSeq) ras-related C3 botulinum toxin substrate 3 isoform X1
  KO
K07861  Ras-related C3 botulinum toxin substrate 3
Organism
pcad  Physeter catodon (sperm whale)
Pathway
pcad04010  MAPK signaling pathway
pcad04014  Ras signaling pathway
pcad04015  Rap1 signaling pathway
pcad04024  cAMP signaling pathway
pcad04062  Chemokine signaling pathway
pcad04071  Sphingolipid signaling pathway
pcad04310  Wnt signaling pathway
pcad04360  Axon guidance
pcad04370  VEGF signaling pathway
pcad04510  Focal adhesion
pcad04520  Adherens junction
pcad04650  Natural killer cell mediated cytotoxicity
pcad04662  B cell receptor signaling pathway
pcad04664  Fc epsilon RI signaling pathway
pcad04810  Regulation of actin cytoskeleton
pcad05135  Yersinia infection
pcad05163  Human cytomegalovirus infection
pcad05170  Human immunodeficiency virus 1 infection
pcad05200  Pathways in cancer
pcad05210  Colorectal cancer
pcad05212  Pancreatic cancer
pcad05231  Choline metabolism in cancer
pcad05416  Viral myocarditis
pcad05418  Fluid shear stress and atherosclerosis
Brite
KEGG Orthology (KO) [BR:pcad00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04010 MAPK signaling pathway
    102992553 (RAC3)
   04014 Ras signaling pathway
    102992553 (RAC3)
   04015 Rap1 signaling pathway
    102992553 (RAC3)
   04310 Wnt signaling pathway
    102992553 (RAC3)
   04370 VEGF signaling pathway
    102992553 (RAC3)
   04071 Sphingolipid signaling pathway
    102992553 (RAC3)
   04024 cAMP signaling pathway
    102992553 (RAC3)
 09140 Cellular Processes
  09144 Cellular community - eukaryotes
   04510 Focal adhesion
    102992553 (RAC3)
   04520 Adherens junction
    102992553 (RAC3)
  09142 Cell motility
   04810 Regulation of actin cytoskeleton
    102992553 (RAC3)
 09150 Organismal Systems
  09151 Immune system
   04650 Natural killer cell mediated cytotoxicity
    102992553 (RAC3)
   04662 B cell receptor signaling pathway
    102992553 (RAC3)
   04664 Fc epsilon RI signaling pathway
    102992553 (RAC3)
   04062 Chemokine signaling pathway
    102992553 (RAC3)
  09158 Development and regeneration
   04360 Axon guidance
    102992553 (RAC3)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    102992553 (RAC3)
   05231 Choline metabolism in cancer
    102992553 (RAC3)
  09162 Cancer: specific types
   05210 Colorectal cancer
    102992553 (RAC3)
   05212 Pancreatic cancer
    102992553 (RAC3)
  09166 Cardiovascular disease
   05418 Fluid shear stress and atherosclerosis
    102992553 (RAC3)
   05416 Viral myocarditis
    102992553 (RAC3)
  09171 Infectious disease: bacterial
   05135 Yersinia infection
    102992553 (RAC3)
  09172 Infectious disease: viral
   05170 Human immunodeficiency virus 1 infection
    102992553 (RAC3)
   05163 Human cytomegalovirus infection
    102992553 (RAC3)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04031 GTP-binding proteins [BR:pcad04031]
    102992553 (RAC3)
GTP-binding proteins [BR:pcad04031]
 Small (monomeric) G-proteins
  Rho Family
   Rac/Cdc42 [OT]
    102992553 (RAC3)
SSDB
Motif
Pfam: Ras Roc Arf
Other DBs
NCBI-GeneID: 102992553
NCBI-ProteinID: XP_023986009
UniProt: A0A2Y9TD67
LinkDB
Position
Unknown
AA seq 192 aa
MQAIKCVVVGDGAVGKTCLLISYTTNAFPGEYIPTVFDNYSANVMVDGKPVNLGLWDTAG
QEDYDRLRPLSYPQTDVFLICFSLVSPASFENVRAKWYPEVRHHCPHTPILLVGTKLDLR
DDKDTIERLRDKKLAPITYPQGLAMAREIGSVKYLECSALTQRGLKTVFDEAIRAVLCPP
PVKKPGKKCTVF
NT seq 579 nt   +upstreamnt  +downstreamnt
atgcaggccatcaagtgcgtggtggtcggcgacggcgccgtggggaagacctgcttgctg
atcagctacacgaccaacgccttccctggagagtacatccccaccgtttttgacaactat
tctgcgaatgtgatggtggacgggaagcctgtcaacctggggctgtgggacaccgctggg
caggaggactacgaccggcttcggccactctcctacccccaaactgacgtctttctgatc
tgcttctccctggtgagcccagcctcctttgagaatgttcgagccaagtggtacccagag
gttcggcaccactgcccccacacgcccatcctcctggtgggcaccaagctggaccttcgt
gacgataaggacaccattgagcggctacgggataagaagctagcgcctatcacttacccc
cagggcctggccatggcccgggagatcggctctgtcaagtacctggagtgctcagccctg
acccagcggggcttgaagactgtgtttgatgaggccatccgggctgtgctctgcccgcct
cctgtgaagaagccggggaagaagtgcacggtcttctag

DBGET integrated database retrieval system