KEGG   Physeter catodon (sperm whale): 102976146
Entry
102976146         CDS       T06011                                 

Gene name
E2F3
Definition
(RefSeq) transcription factor E2F3 isoform X1
  KO
K06620  transcription factor E2F3
Organism
pcad  Physeter catodon (sperm whale)
Pathway
pcad01522  Endocrine resistance
pcad04110  Cell cycle
pcad04218  Cellular senescence
pcad04934  Cushing syndrome
pcad05160  Hepatitis C
pcad05161  Hepatitis B
pcad05163  Human cytomegalovirus infection
pcad05166  Human T-cell leukemia virus 1 infection
pcad05167  Kaposi sarcoma-associated herpesvirus infection
pcad05169  Epstein-Barr virus infection
pcad05200  Pathways in cancer
pcad05206  MicroRNAs in cancer
pcad05212  Pancreatic cancer
pcad05214  Glioma
pcad05215  Prostate cancer
pcad05218  Melanoma
pcad05219  Bladder cancer
pcad05220  Chronic myeloid leukemia
pcad05222  Small cell lung cancer
pcad05223  Non-small cell lung cancer
pcad05224  Breast cancer
pcad05225  Hepatocellular carcinoma
pcad05226  Gastric cancer
Brite
KEGG Orthology (KO) [BR:pcad00001]
 09140 Cellular Processes
  09143 Cell growth and death
   04110 Cell cycle
    102976146 (E2F3)
   04218 Cellular senescence
    102976146 (E2F3)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    102976146 (E2F3)
   05206 MicroRNAs in cancer
    102976146 (E2F3)
  09162 Cancer: specific types
   05212 Pancreatic cancer
    102976146 (E2F3)
   05225 Hepatocellular carcinoma
    102976146 (E2F3)
   05226 Gastric cancer
    102976146 (E2F3)
   05214 Glioma
    102976146 (E2F3)
   05220 Chronic myeloid leukemia
    102976146 (E2F3)
   05218 Melanoma
    102976146 (E2F3)
   05219 Bladder cancer
    102976146 (E2F3)
   05215 Prostate cancer
    102976146 (E2F3)
   05224 Breast cancer
    102976146 (E2F3)
   05222 Small cell lung cancer
    102976146 (E2F3)
   05223 Non-small cell lung cancer
    102976146 (E2F3)
  09167 Endocrine and metabolic disease
   04934 Cushing syndrome
    102976146 (E2F3)
  09172 Infectious disease: viral
   05166 Human T-cell leukemia virus 1 infection
    102976146 (E2F3)
   05161 Hepatitis B
    102976146 (E2F3)
   05160 Hepatitis C
    102976146 (E2F3)
   05163 Human cytomegalovirus infection
    102976146 (E2F3)
   05167 Kaposi sarcoma-associated herpesvirus infection
    102976146 (E2F3)
   05169 Epstein-Barr virus infection
    102976146 (E2F3)
  09176 Drug resistance: antineoplastic
   01522 Endocrine resistance
    102976146 (E2F3)
Transcription factors [BR:pcad03000]
 Eukaryotic type
  Helix-turn-helix
   Fork head/winged helix cell cycle-controlling factors, E2F
    102976146 (E2F3)
SSDB
Motif
Pfam: E2F_CC-MB E2F_TDP
Other DBs
NCBI-GeneID: 102976146
NCBI-ProteinID: XP_023977574
UniProt: A0A2Y9SPC6
LinkDB
Position
18
AA seq 467 aa
MRKGIQPALEQYLVTAGGGEGAAVVAAAAAASMDKRALLASPGFPAAATAAAAAAPSAYI
QILTTNTSTTSCSSSLQSGAVAAGPLLPSAPGVEQTAGSLLYTTPHGPSSRAGLLQQPPA
LGRGGGGGGGGPPAKRRLELGESGQQYLSDGLKTPKGKGRAALRSPDSPKTPKSPSEKTR
YDTSLGLLTKKFIQLLSQSPDGVLDLNKAAEVLKVQKRRIYDITNVLEGIHLIKKKSKNN
VQWMGCSLSEDGGMLAQCQGLSKEVTELSQEEKKLDELIQSCTLDLKLLTEDSENQRLAY
VTYQDIRKISGLKDQTVIVVKAPPETRLEVPDPIESLQIHLASTQGPIEVYLCPEETETH
SPMKTNNQDHNGNISKPTSKDLASTNSGHSDCSISMANLSPLASPANLLQQTEDQIPSNL
EGPFVNLLPPLLQEDYLLSLGEEEGISDLFDAYDLEKLPLVEDFMCS
NT seq 1404 nt   +upstreamnt  +downstreamnt
atgagaaaggggatccagcccgccctggagcagtacctggtgaccgccgggggtggggag
ggggcggctgtcgtcgccgccgccgctgcagcctccatggacaaaagggcactgctagcc
agccccggcttccccgccgccgccaccgccgctgctgccgccgccccgagcgcgtacatc
cagatcctcaccacgaacacttccaccacctcctgttcctcctccctccaaagcggcgcc
gtcgccgccggccccctcctccccagtgcccccggcgtggagcagaccgccggcagcctc
ctctacaccacgccgcacggaccctccagcagagccgggctgctgcagcagccaccagcg
ctgggacgcggcggcggcggcggcggcggcggccctccggcaaagcgcaggctggagcta
ggagaaagcggtcagcagtacctctcagatggtttaaaaacccccaagggcaaaggaaga
gctgcgctccgaagtccagatagtccaaaaactccaaaatctccctcagaaaaaacacgg
tatgatacatcacttggtctgctcaccaagaagttcattcagctactgagccaatcacct
gatggggtcttggatttgaacaaggcagcagaggtgctgaaggtgcaaaagagaaggatt
tatgacatcaccaatgtactggaaggcatccacctcattaagaagaagtctaaaaacaac
gtgcagtggatgggctgcagtctgtctgaggacgggggcatgctggcccagtgtcaaggc
ctgtctaaagaagtgaccgagctcagtcaggaagagaagaaattagatgaactgatccaa
agctgcaccctggacctcaaactgttaaccgaggattcagagaatcaaaggttagcttat
gttacatatcaagatattcgaaaaattagtggccttaaagaccaaactgttatagttgtg
aaagcccctccagaaacaagacttgaagtgcctgacccaatagagagcctacaaatacat
ttggcaagtacccaaggacccattgaggtttatttgtgtccagaagagactgaaacacac
agtccaatgaaaacaaacaaccaagaccacaatgggaatatctctaaacccacttccaaa
gacttggcttcaaccaactcaggacatagtgattgctcgatttctatggcaaacctttct
cctttggcctccccagccaaccttttacagcagactgaggaccaaattccttccaaccta
gaaggaccatttgtgaacttactgccccccctgctccaagaagactatctcctaagcctt
ggggaggaagaaggcatcagcgatctctttgatgcttacgatttggaaaagctcccactg
gtggaagactttatgtgtagctga

KEGG   Physeter catodon (sperm whale): 102993481
Entry
102993481         CDS       T06011                                 

Gene name
E2F1
Definition
(RefSeq) transcription factor E2F1 isoform X1
  KO
K17454  transcription factor E2F1
Organism
pcad  Physeter catodon (sperm whale)
Pathway
pcad01522  Endocrine resistance
pcad04110  Cell cycle
pcad04137  Mitophagy - animal
pcad04218  Cellular senescence
pcad04934  Cushing syndrome
pcad05160  Hepatitis C
pcad05161  Hepatitis B
pcad05163  Human cytomegalovirus infection
pcad05165  Human papillomavirus infection
pcad05166  Human T-cell leukemia virus 1 infection
pcad05167  Kaposi sarcoma-associated herpesvirus infection
pcad05169  Epstein-Barr virus infection
pcad05200  Pathways in cancer
pcad05206  MicroRNAs in cancer
pcad05212  Pancreatic cancer
pcad05214  Glioma
pcad05215  Prostate cancer
pcad05218  Melanoma
pcad05219  Bladder cancer
pcad05220  Chronic myeloid leukemia
pcad05222  Small cell lung cancer
pcad05223  Non-small cell lung cancer
pcad05224  Breast cancer
pcad05225  Hepatocellular carcinoma
pcad05226  Gastric cancer
Brite
KEGG Orthology (KO) [BR:pcad00001]
 09140 Cellular Processes
  09141 Transport and catabolism
   04137 Mitophagy - animal
    102993481 (E2F1)
  09143 Cell growth and death
   04110 Cell cycle
    102993481 (E2F1)
   04218 Cellular senescence
    102993481 (E2F1)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    102993481 (E2F1)
   05206 MicroRNAs in cancer
    102993481 (E2F1)
  09162 Cancer: specific types
   05212 Pancreatic cancer
    102993481 (E2F1)
   05225 Hepatocellular carcinoma
    102993481 (E2F1)
   05226 Gastric cancer
    102993481 (E2F1)
   05214 Glioma
    102993481 (E2F1)
   05220 Chronic myeloid leukemia
    102993481 (E2F1)
   05218 Melanoma
    102993481 (E2F1)
   05219 Bladder cancer
    102993481 (E2F1)
   05215 Prostate cancer
    102993481 (E2F1)
   05224 Breast cancer
    102993481 (E2F1)
   05222 Small cell lung cancer
    102993481 (E2F1)
   05223 Non-small cell lung cancer
    102993481 (E2F1)
  09167 Endocrine and metabolic disease
   04934 Cushing syndrome
    102993481 (E2F1)
  09172 Infectious disease: viral
   05166 Human T-cell leukemia virus 1 infection
    102993481 (E2F1)
   05161 Hepatitis B
    102993481 (E2F1)
   05160 Hepatitis C
    102993481 (E2F1)
   05163 Human cytomegalovirus infection
    102993481 (E2F1)
   05167 Kaposi sarcoma-associated herpesvirus infection
    102993481 (E2F1)
   05169 Epstein-Barr virus infection
    102993481 (E2F1)
   05165 Human papillomavirus infection
    102993481 (E2F1)
  09176 Drug resistance: antineoplastic
   01522 Endocrine resistance
    102993481 (E2F1)
Transcription factors [BR:pcad03000]
 Eukaryotic type
  Helix-turn-helix
   Fork head/winged helix cell cycle-controlling factors, E2F
    102993481 (E2F1)
SSDB
Motif
Pfam: E2F_CC-MB E2F_TDP TP1
Other DBs
NCBI-GeneID: 102993481
NCBI-ProteinID: XP_007105961
UniProt: A0A2Y9EPY9
LinkDB
Position
Unknown
AA seq 363 aa
MAFLSTLFASPTPVKRRLDLETDHQYLAESSGSARGRGRHPGKGVKSPGEKSRYETSLNL
TTKRFLELLSRSADGVVDLNWAAEVLKVQKRRIYDITNVLEGIQLIAKKSKNHIQWLGSH
AAVGIGGRLEGLTQDLQQLQESERQLDHLIHICTTQLRLLSEDADSQRLAYVTCQDLRSI
ADPAEQMVMVIKAPPETQLQAVDSSETFQISLKSKQGPIDVFLCPEESAGGISPGKTPSQ
GAASGEEDRAADPATTVPPPPSSPPSSPATDPSQSLLSLEQEPLLSRMGSLRAPVDEDRL
SPLVAADSLLEHVREDFAGLLPEEFISLSPPHEALDYHFGLEEGEGIRDLFDCDFGDLTP
LDF
NT seq 1092 nt   +upstreamnt  +downstreamnt
atggcgtttctgtccacgttgttcgcttctcccactcccgtgaagcggaggctggacttg
gaaactgaccatcagtacctggccgagagcagtgggtcagctcggggcagaggccgccac
ccaggaaaaggtgtgaaatccccaggggagaagtcacgctatgaaacatcgctgaatctg
actaccaagcgcttcctggagttgctgagccgctcggccgatggtgtcgtcgacctgaac
tgggcagctgaggtgctgaaggtgcagaaacggcgcatctatgacatcaccaacgtcctt
gagggcatccagctcatcgccaagaagtccaagaaccacatccagtggctaggcagccat
gcagcagtggggatcggtgggcggcttgaaggattgacccaggacctccagcaactgcag
gaaagcgagcggcagctggaccacctgatccacatctgcaccacgcagctgcgtctgctt
tctgaggatgctgacagccagcgcctggcctacgtgacctgccaggaccttcgtagcatt
gcagaccctgcagaacagatggttatggtgatcaaggcccctcccgagacccagcttcaa
gccgtggactcctcagagacctttcagatctcccttaagagcaaacaaggccccatcgat
gttttcctgtgccctgaggagagtgcgggcgggatcagccccgggaagaccccgtcccag
ggtgcagcttccggggaggaggacagggcagctgaccctgccaccacagtgccaccacca
ccatcatctcccccctcatcccctgccacggatcccagtcagtccctgctaagcctggag
caagaacctctgctttcccggatgggcagcctgagggcccccgtggacgaggaccgccta
tccccactggtggcggccgactcgctcctggagcacgtgcgggaggacttcgccggcctc
ctccccgaggagttcatcagcctgtcccccccgcacgaggccctcgactaccacttcggc
cttgaggagggcgagggcatcagagacctcttcgactgtgactttggggacctcactccc
ctggatttctga

KEGG   Physeter catodon (sperm whale): 102996979
Entry
102996979         CDS       T06011                                 

Definition
(RefSeq) transcription factor E2F2
  KO
K09389  transcription factor E2F2
Organism
pcad  Physeter catodon (sperm whale)
Pathway
pcad01522  Endocrine resistance
pcad04110  Cell cycle
pcad04218  Cellular senescence
pcad04934  Cushing syndrome
pcad05160  Hepatitis C
pcad05161  Hepatitis B
pcad05163  Human cytomegalovirus infection
pcad05166  Human T-cell leukemia virus 1 infection
pcad05167  Kaposi sarcoma-associated herpesvirus infection
pcad05169  Epstein-Barr virus infection
pcad05200  Pathways in cancer
pcad05206  MicroRNAs in cancer
pcad05212  Pancreatic cancer
pcad05214  Glioma
pcad05215  Prostate cancer
pcad05218  Melanoma
pcad05219  Bladder cancer
pcad05220  Chronic myeloid leukemia
pcad05222  Small cell lung cancer
pcad05223  Non-small cell lung cancer
pcad05224  Breast cancer
pcad05225  Hepatocellular carcinoma
pcad05226  Gastric cancer
Brite
KEGG Orthology (KO) [BR:pcad00001]
 09140 Cellular Processes
  09143 Cell growth and death
   04110 Cell cycle
    102996979
   04218 Cellular senescence
    102996979
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    102996979
   05206 MicroRNAs in cancer
    102996979
  09162 Cancer: specific types
   05212 Pancreatic cancer
    102996979
   05225 Hepatocellular carcinoma
    102996979
   05226 Gastric cancer
    102996979
   05214 Glioma
    102996979
   05220 Chronic myeloid leukemia
    102996979
   05218 Melanoma
    102996979
   05219 Bladder cancer
    102996979
   05215 Prostate cancer
    102996979
   05224 Breast cancer
    102996979
   05222 Small cell lung cancer
    102996979
   05223 Non-small cell lung cancer
    102996979
  09167 Endocrine and metabolic disease
   04934 Cushing syndrome
    102996979
  09172 Infectious disease: viral
   05166 Human T-cell leukemia virus 1 infection
    102996979
   05161 Hepatitis B
    102996979
   05160 Hepatitis C
    102996979
   05163 Human cytomegalovirus infection
    102996979
   05167 Kaposi sarcoma-associated herpesvirus infection
    102996979
   05169 Epstein-Barr virus infection
    102996979
  09176 Drug resistance: antineoplastic
   01522 Endocrine resistance
    102996979
Transcription factors [BR:pcad03000]
 Eukaryotic type
  Helix-turn-helix
   Fork head/winged helix cell cycle-controlling factors, E2F
    102996979
SSDB
Motif
Pfam: E2F_TDP E2F_CC-MB FerA
Other DBs
NCBI-GeneID: 102996979
NCBI-ProteinID: XP_028341571
UniProt: A0A455BC57
LinkDB
Position
Unknown
AA seq 295 aa
MLRGPRALAPASGPPLKGLPAMSPTELWPPGLSSPQLCPVTTTYYTQLYPQTVPPAAAPG
TCLDATPHGPEGQAVRCVPAGRLPAKRKLDLEGIGKPVVPEFRTPKRKCIKVDGLPSPKT
PKSPGEKTRYDTSLGLLTKKFIYLLSESEDGVLDLNWAAEVLDVQKRRIYDITNVLEGIQ
LIRKKAKNNIQWVGRGLFEDPTRPGKQQQLGQELKELMSMEQALDQLIQSCSLNFKHLTE
DKANKRLAYVTYQDIRAVGSFKEQTVIAVKAPPQTRLEVPDRSEVRGEAFSGEQG
NT seq 888 nt   +upstreamnt  +downstreamnt
atgctgcgagggccgcgggccctggctccggcctcggggccgcccctcaaggggctgccc
gcgatgagccccacggagctgtggccgcccggcctcagcagccctcagctctgcccggtc
accaccacctactacacccagctgtacccgcagactgtgcctcccgctgcggcgccgggc
acctgcctcgacgccaccccccacggaccggagggccaagctgtgcgatgcgtgcctgct
ggccggctgccggccaaaagaaagctggacctggaggggattggaaagcctgtggtccct
gaattccggactcccaagcggaagtgcattaaagtggatggcctccccagccccaaaacc
cccaagtcgcctggggagaagactcgctatgacacgtcgctggggctgctcaccaagaaa
ttcatttacctcctgagcgagtctgaggatggggtcctggaccttaactgggctgctgag
gtgctggacgtgcagaagcggcgcatctacgacataaccaatgtgctggagggaatccag
ctcatccgcaagaaggccaagaacaacatccagtgggtaggcagaggactgtttgaagac
cccacccggcctgggaagcagcagcagctggggcaggagctgaaggaactaatgagcatg
gagcaggccttggaccaactcatccagagctgctctctgaacttcaagcacctgacggag
gacaaggccaacaagagactggcctacgtgacttaccaggacatccgtgctgtgggcagc
tttaaggagcagacggtgatcgctgtcaaggcccctccgcagacgagactggaagtgcct
gacaggagcgaggtgagaggggaagcatttagtggagagcagggttag

DBGET integrated database retrieval system