KEGG   Physeter catodon (sperm whale): 102976588
Entry
102976588         CDS       T06011                                 

Gene name
ITGA1
Definition
(RefSeq) integrin alpha-1 isoform X1
  KO
K06480  integrin alpha 1
Organism
pcad  Physeter catodon (sperm whale)
Pathway
pcad04151  PI3K-Akt signaling pathway
pcad04510  Focal adhesion
pcad04512  ECM-receptor interaction
pcad04640  Hematopoietic cell lineage
pcad04810  Regulation of actin cytoskeleton
pcad05165  Human papillomavirus infection
pcad05410  Hypertrophic cardiomyopathy
pcad05412  Arrhythmogenic right ventricular cardiomyopathy
pcad05414  Dilated cardiomyopathy
Brite
KEGG Orthology (KO) [BR:pcad00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04151 PI3K-Akt signaling pathway
    102976588 (ITGA1)
  09133 Signaling molecules and interaction
   04512 ECM-receptor interaction
    102976588 (ITGA1)
 09140 Cellular Processes
  09144 Cellular community - eukaryotes
   04510 Focal adhesion
    102976588 (ITGA1)
  09142 Cell motility
   04810 Regulation of actin cytoskeleton
    102976588 (ITGA1)
 09150 Organismal Systems
  09151 Immune system
   04640 Hematopoietic cell lineage
    102976588 (ITGA1)
 09160 Human Diseases
  09166 Cardiovascular disease
   05410 Hypertrophic cardiomyopathy
    102976588 (ITGA1)
   05412 Arrhythmogenic right ventricular cardiomyopathy
    102976588 (ITGA1)
   05414 Dilated cardiomyopathy
    102976588 (ITGA1)
  09172 Infectious disease: viral
   05165 Human papillomavirus infection
    102976588 (ITGA1)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:pcad04147]
    102976588 (ITGA1)
   04515 Cell adhesion molecules [BR:pcad04515]
    102976588 (ITGA1)
   04090 CD molecules [BR:pcad04090]
    102976588 (ITGA1)
Exosome [BR:pcad04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   102976588 (ITGA1)
Cell adhesion molecules [BR:pcad04515]
 Integrins
  Integrin alpha subunits
   102976588 (ITGA1)
CD molecules [BR:pcad04090]
 Proteins
  102976588 (ITGA1)
SSDB
Motif
Pfam: Integrin_alpha2 VWA FG-GAP VWA_2 VCBS FG-GAP_2 LYRIC Integrin_alpha Cation_ATPase_N
Other DBs
NCBI-GeneID: 102976588
NCBI-ProteinID: XP_007106875
UniProt: A0A2Y9T021
LinkDB
Position
8
AA seq 1178 aa
MAPRRRASPGVAVACCWLLTVLGFCISFNVDVKNSLTFSGPVEDMFGYTVQQYENEEGKW
VLIGSPLVGQPKNRTGDVYKCPVGRGESLPCIKLDLPVNTSIPNVTEVKENMTFGSTLVT
NPNGGFLACGPLYAYRCGHLHYTTGICSDVSPTFQVVNSIAPVQECSTQLDIVIVLDGSN
SIYPWESVTAFLNDLLERMDIGPKQTQVGIVQYGENVTHEFNLNKYSSTEEVLVAANKIV
QRGGRQTMTALGIDTARKEAFTEARGARRGVKKVMVIVTDGESHDNHQLNKVIQGCEDES
IQRFSIAILGSYNRGNLSTEKFVEEIKSIASEPTEKHFFNVSDELALVTIVEALGERIFA
LEATADQSAASFEMEMSQTGFSAHYSQDWVMLGAVGAYDWNGTVVMQKANQILIPQNTTF
NVESTKKNEPLASYLGYTVNSATVSGDVLYIAGQPRYNHTGQVVIYRMEDGDIRILQTLH
GEQIGSYFGSVLTTIDIDKDSNTDILLVGAPMFMGTEKEEQGKVYIYALNQTRFEYQMSL
EPMKQTCCSSLKHNSCTKENKNEPCGARFGTAISAVKDLNLDGFNDIVIGAPLEDDHGGA
VYIYHGSGKTIREEYAQRIPSGGDGETLKFFGQSIHGEMDLNGDGLTDVTIGGLGGAALF
WSRDVAVVKVTMNFEPNKVNIQKKNCRVEGKETVCINATVCFDVKLKSKEDRVYEADMQY
RITLDSLRQISRSFFSGTQERKIQRNITVQESECTKHSFYMLDKHDFRDSVRITLDFNLT
DPENGPVLDDSLPNSVHEYIPFAKDCGNKEKCISDLALDVSTTEKGLFIVRSHNDKFNVS
LTVKNKEDSAYNTRTIVNYSPNLIFSGIEAIQKDSCESNHNITCKVGYPFLRRGEMVTFK
ILFQFNSSYLMENVIIHLSTTSDSEEPPEALFDNEVNVSIPVKYEVGLQFYSSASEYHIS
IAANETVPEVISSTEDIGNEINIFYLIRKSGHFPMPELKLSISFPNMTSDGFPVLYSSGW
SSSENVTCRPSSLQDPFGINSGKKMIISKSEDIKRGTILDCSACKFATITCNLIPSDMSQ
VNVSLILWKPTFIKAHFSSLNLTVGAELQSENTSLVLSAGNQKRELAIQISKDGLPGRVP
LWVILLSAFAGLLLLMLLILALWKIGFFKRPLKKKMEK
NT seq 3537 nt   +upstreamnt  +downstreamnt
atggccccccggcgccgcgccagcccaggggtcgctgtcgcctgctgctggctcctcacc
gttctaggcttctgcatatcattcaatgttgatgtgaaaaactcattgactttcagcggc
ccagtggaggacatgtttggatatactgttcaacaatatgaaaatgaagaaggaaaatgg
gtgcttattggttctcctttagttggacaacccaagaacagaactggagatgtctataag
tgtccagttgggagaggtgaatcattaccttgcataaagttggatcttccagttaataca
tcaattcccaatgtcacagaagtaaaggagaatatgacatttggatcaactttagtcacc
aacccaaatggagggtttctggcatgcgggcccttatatgcctatagatgtggacatttg
cattacacaacgggaatctgttctgatgtcagccccacatttcaagtcgtgaactccatt
gcccctgtacaagaatgcagcactcagctggacatagtcatagtgctggatggttccaac
agtatttacccctgggaaagtgttacagcttttttaaatgaccttcttgaaagaatggat
attggtcctaaacagacacaggttggaattgtacagtatggggaaaatgtaacccatgag
ttcaacctcaataagtactcatcgacggaagaggtgcttgttgctgcaaataaaatagtc
cagagaggtggccgccagacgatgacagcccttggaatagacacagcaaggaaagaggct
ttcactgaagcccggggtgcccgaagaggggttaaaaaagtcatggtaattgtgactgat
ggagagtcccatgacaaccaccaactgaataaggtcatccagggctgtgaggacgaaagc
attcagcggttttccatagctattcttggcagctataatcgaggaaatttaagcactgaa
aaatttgtggaggaaataaaatcaattgcgagtgaacccactgaaaagcatttctttaac
gtctctgatgaattggcactagtcactattgttgaagctctgggagaaagaatctttgcc
ctggaagctacagctgaccagtcggcagcttcttttgagatggaaatgtctcagaccggc
ttcagtgctcattattcacaggactgggtcatgcttggagcggtaggagcctatgactgg
aacggaacagttgtcatgcagaaggctaatcaaatcctaattccccaaaacacgaccttt
aatgttgagtctaccaaaaagaatgaacctcttgcttcttatttaggttacacagtaaac
tccgccactgtttctggagatgtgctctacattgccggacagccacggtacaatcataca
ggccaggtggtcatctacaggatggaggatggagacatcaggattctccagacactccat
ggagaacagatcggttcctactttggaagtgttttaacgacaattgacattgataaagat
tctaatactgacattcttctagtcggggctcccatgttcatgggaacagagaaggaggaa
caaggaaaagtgtacatctatgctctgaatcagacaaggtttgaatatcaaatgagcctg
gaacccatgaagcagacttgctgttcgtctctgaagcacaattcatgcacaaaggaaaac
aaaaatgaaccatgtggggctcgttttggaacagctatttctgctgtgaaagacctcaat
cttgatggatttaatgacatcgtgataggagcacccctggaagatgatcatgggggagcc
gtgtacatttatcatggaagtggcaagactataagggaagagtatgcacaacgtattcca
tcagggggagatggcgagacactgaaattttttggccagtctatccacggagaaatggat
ttaaatggtgacggtctgactgatgtcactattgggggccttggtggtgctgccctcttc
tggtctcgagatgtggctgtagttaaagtgaccatgaattttgaacccaataaagtgaat
attcaaaagaaaaactgccgcgtggagggaaaggaaacagtatgcataaatgccacagtg
tgctttgatgtgaaattgaagtccaaagaagacagggtttacgaagctgatatgcagtac
cgtatcacactagattctctaagacagatatcacggagttttttctctggaactcaagag
aggaagattcaaagaaacatcacagttcaagaatcagaatgcactaagcattccttctac
atgttggacaagcatgactttcgggactctgtgagaataactttggattttaatcttacc
gatccagaaaatgggcccgttctcgatgattctttaccaaattcagtacatgaatatatt
ccctttgccaaagattgtggaaacaaggaaaaatgtatctcggacctcgccctggatgtc
tccaccacagaaaagggcctgtttattgtcaggtcccacaatgataagttcaatgttagc
ctcacagtcaaaaataaagaggacagtgcctataacaccagaaccatagtgaattattct
ccaaatctaattttttcaggaattgaggctatccaaaaagacagttgtgaatccaatcat
aatatcacatgtaaagttggatatcctttcctaagaagaggagaaatggtaacattcaaa
atattatttcagtttaactcatcttatctcatggaaaatgtgatcattcatttaagtaca
acaagtgacagtgaagagccacctgaagccctttttgataatgaagtaaacgtttctatc
cctgtaaaatatgaagttggactacagttttacagctctgcaagtgaataccatatttca
attgcggccaacgagacagtccctgaagttattagttctactgaggacattggaaatgaa
attaatatcttctacttgattagaaaaagtgggcattttccaatgccagaacttaagctg
tcaatttcattccccaacatgacatcagatggttttcctgtactgtactcaagtgggtgg
tcatcttctgagaatgtcacctgcagacccagtagcctccaggatccttttggtatcaac
tctgggaagaaaatgataatatccaaatctgaagatatcaaacgaggcaccattctggac
tgcagtgcatgtaaatttgccaccatcacatgtaatctgattccttctgacatgagccaa
gtgaatgtttcacttatcttatggaaaccaacttttataaaagcacatttttccagctta
aatcttactgtaggggcagaacttcagagtgaaaatacatcactagttttaagtgctggc
aatcaaaaaagagagcttgctattcaaatatccaaagatgggctaccaggcagagtaccg
ttatgggttatcctgttgagtgcttttgctggattattgctattaatgctgctcatatta
gcactgtggaagattggattcttcaaaagaccactaaagaagaaaatggagaaatga

KEGG   Physeter catodon (sperm whale): 102977795
Entry
102977795         CDS       T06011                                 

Gene name
ITGA2
Definition
(RefSeq) integrin alpha-2
  KO
K06481  integrin alpha 2
Organism
pcad  Physeter catodon (sperm whale)
Pathway
pcad04145  Phagosome
pcad04151  PI3K-Akt signaling pathway
pcad04510  Focal adhesion
pcad04512  ECM-receptor interaction
pcad04611  Platelet activation
pcad04640  Hematopoietic cell lineage
pcad04810  Regulation of actin cytoskeleton
pcad05165  Human papillomavirus infection
pcad05200  Pathways in cancer
pcad05205  Proteoglycans in cancer
pcad05222  Small cell lung cancer
pcad05410  Hypertrophic cardiomyopathy
pcad05412  Arrhythmogenic right ventricular cardiomyopathy
pcad05414  Dilated cardiomyopathy
Brite
KEGG Orthology (KO) [BR:pcad00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04151 PI3K-Akt signaling pathway
    102977795 (ITGA2)
  09133 Signaling molecules and interaction
   04512 ECM-receptor interaction
    102977795 (ITGA2)
 09140 Cellular Processes
  09141 Transport and catabolism
   04145 Phagosome
    102977795 (ITGA2)
  09144 Cellular community - eukaryotes
   04510 Focal adhesion
    102977795 (ITGA2)
  09142 Cell motility
   04810 Regulation of actin cytoskeleton
    102977795 (ITGA2)
 09150 Organismal Systems
  09151 Immune system
   04640 Hematopoietic cell lineage
    102977795 (ITGA2)
   04611 Platelet activation
    102977795 (ITGA2)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    102977795 (ITGA2)
   05205 Proteoglycans in cancer
    102977795 (ITGA2)
  09162 Cancer: specific types
   05222 Small cell lung cancer
    102977795 (ITGA2)
  09166 Cardiovascular disease
   05410 Hypertrophic cardiomyopathy
    102977795 (ITGA2)
   05412 Arrhythmogenic right ventricular cardiomyopathy
    102977795 (ITGA2)
   05414 Dilated cardiomyopathy
    102977795 (ITGA2)
  09172 Infectious disease: viral
   05165 Human papillomavirus infection
    102977795 (ITGA2)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:pcad04147]
    102977795 (ITGA2)
   04515 Cell adhesion molecules [BR:pcad04515]
    102977795 (ITGA2)
   04090 CD molecules [BR:pcad04090]
    102977795 (ITGA2)
Exosome [BR:pcad04147]
 Exosomal proteins
  Exosomal proteins of colorectal cancer cells
   102977795 (ITGA2)
  Exosomal proteins of bladder cancer cells
   102977795 (ITGA2)
Cell adhesion molecules [BR:pcad04515]
 Integrins
  Integrin alpha subunits
   102977795 (ITGA2)
CD molecules [BR:pcad04090]
 Proteins
  102977795 (ITGA2)
SSDB
Motif
Pfam: Integrin_alpha2 VWA FG-GAP VWA_2 FG-GAP_2 VCBS Integrin_alpha HisK_sensor
Other DBs
NCBI-GeneID: 102977795
NCBI-ProteinID: XP_028349227
UniProt: A0A455BKE5
LinkDB
Position
8
AA seq 1099 aa
MASQKAETPSKSLKVGNQISSLFGEEGILNCCVAYNVGLPEAKIFSGPSSEQFGYAVQQF
INPEGNWLLVGSPWSGFPENRMGDVYKCPVDLSTTTCEKLNLQTSTSISNVTEMKTNMSL
GLTLTRNVGTGGFLTCGPLWAQQCGSQFYTTGLCSDVSPNFQLLTSFSPAVQTCPSLIDV
VVVCDESNSIYPWDAVKNFLEKFVQGLDIGPTKTQVGLIQYANYPRVVFNLNTFKTKDEM
IKATSQTSQYGGDLTNTFKAIQYARCPLEPSHLKGCWPVAIMRSTVQGGDNFQMEMSQVG
FSADYSPQNDILMLGAVGAYDWSGTVVQQTPHGHLIFPKQAFDQILQDRNHSSYLGYSVA
SISTGTSVHFVAGAPRANYTGQIVLYSVNESGNITVIQSHRGDQIGSYFGSVLCAVDVDK
DTITDVLLVGAPMYMNDLKKEEGRVYLFIITKGVLNWHQFLEGPEGVENARFGSAIAALS
DINMDGFNDVIVGSPLENQNSGAVYIYNGHEGTIRLRYSQKILGSDGAFRSHLQYFGRSL
DGYGDLNGDSITDVSVGAFGQVIQLWSQSIADVSVVASFTPEKITLLNKNAEINLKLCFS
AKFRPAKQNNQVAIVYNITIDADQYSSRVTSRGLFKENNERCLQKTMIVNQAQSCSEYII
HIQEPSDVVSSLDLCVNISLENPGTNPALEAYSETVKVFSIPFYKDCGDDGVCISDLVLD
VQQLPAAQQQPFIVSNQNKRLTFSVTLKNKKESAYNSGIVVDFSENLFFASWSMPVDGTE
VTCQIASSQKSVTCNVGYPALKREQQVTFTINFDFNLQNLQNQASVSFQALSESYEENQA
DNSVNFKLSLLYDAEIHITRSTNINFYEVSSDGNIPSIVNNFEDIGPKFIFSIKVTTGSV
PVSMASVIIHIPQYTKGKNPVMYLTGVHTDQAGDISCKAEINPLKIGQTSSSVSFKSENF
RHVKELNCRTASCSNVTCWLKDLQVKGEYFLNVSTRIWNGTFAVSTFQTVQLTAAAEIDT
YNPQIYAIEENTVTIPITIMKPHEKAQVPTGVIVGSAIAGILLLLALVAILWKLGFFKRK
YEKMTKNPDEIDETTELNS
NT seq 3300 nt   +upstreamnt  +downstreamnt
atggcaagccaaaaagctgagacaccgagtaaatcgcttaaagttggcaaccaaatcagc
tccttatttggagaggaaggcattttaaattgctgtgtggcgtacaatgttggtctcccg
gaagcaaagatattttctggtccttcaagtgaacagtttggctatgcagtgcagcagttc
ataaatccagaaggcaactggttactggttggttcaccatggagtggctttcctgagaac
cgaatgggagatgtgtataaatgtcctgttgatctgtccaccactacatgtgaaaaactg
aatttgcaaacttccacgagcatttccaacgttactgagatgaaaaccaacatgagcctt
ggcttgacactgacgaggaacgtgggaacgggaggatttcttacctgtggtccgctgtgg
gcacagcagtgtggaagtcagttttacacaaccgggttatgctctgatgtcagtcccaat
tttcagctcctgaccagcttttcacctgcagttcagacctgcccttccctcatagatgtt
gtggttgtatgtgatgaatcaaacagtatttatccctgggatgcagtaaagaactttttg
gaaaaatttgtgcaaggcctggatataggccccacaaagacacaggtggggttaatccag
tatgccaattatccaagagttgtgtttaacctgaacacttttaaaaccaaagatgaaatg
attaaagcaacatcccagacatcccaatatggtggagacctcacaaatacattcaaagca
attcaatatgcaagatgtcctttggagccaagccatctcaagggctgctggccagttgcc
attatgagaagtactgttcaaggaggagacaacttccaaatggagatgtcacaagtggga
ttcagcgcagattactctcctcaaaatgatattttgatgctgggtgcagtaggagcttat
gactggagtgggactgttgtccagcagacacctcatggacatttgatctttcctaaacaa
gcttttgaccaaattctgcaagacagaaatcacagttcatatttaggttactctgtggct
tcaatttctactggaacaagtgtccactttgttgctggagctcctcgggcaaattatacc
ggccagatagtgctgtacagtgttaatgagagtggcaatatcacagttattcagtctcac
agaggtgaccagattggctcctattttggtagtgtgttgtgtgcagtcgatgtggacaaa
gacaccattacagatgtgctcttggtaggtgcgccaatgtacatgaatgacctaaagaaa
gaggaaggaagagtctacctgtttattatcacaaagggcgttttgaattggcaccaattt
ctggaaggccccgagggtgttgaaaatgctcggtttggttcagcgattgcagctctttca
gacatcaatatggatggctttaatgatgtgatcgttggttcacctttggaaaatcagaac
tctggagctgtgtacatctacaatggtcatgagggcaccattcgcctgaggtattcccag
aaaatcttggggtctgatggagcctttaggagccacctccagtactttgggagatccctg
gatggctatggagatttaaatggggattccatcactgatgtgtctgttggtgcctttgga
caggtcattcagctctggtcacagagtattgctgatgtatctgtagttgcttcgttcaca
ccagaaaaaatcactttgctcaacaagaacgctgagataaaccttaaactctgtttcagc
gccaagtttagacctgctaagcaaaacaatcaagtggccattgtatataatatcacaatt
gatgcagaccaatattcatccagagtaacctccaggggattatttaaagaaaataatgaa
aggtgcttgcagaagaccatgatagtaaatcaagcacagagttgctctgagtacatcatc
cacatacaggagccctctgatgttgtcagctctctggatctgtgtgtgaacatcagtctg
gaaaaccctggcactaaccctgccctcgaagcctactctgagacagtcaaggtcttcagt
atccctttctataaagattgtggtgatgatggagtttgcatctctgatctagttctagat
gttcaacagctaccagcagctcaacaacagcccttcattgtcagcaaccaaaacaaaagg
ttaacattttcagtaacactgaaaaacaaaaaggaaagcgcatacaacagtgggattgtt
gttgatttttcagaaaatctgttttttgcttcctggtccatgccggttgatgggacagaa
gtgacatgccagattgcttcatctcagaagtctgttacctgcaatgtgggctaccctgct
ttaaaaagggaacaacaggtgactttcactattaacttcgacttcaatcttcaaaacctt
cagaatcaggcctctgtcagtttccaagccttaagtgaaagctacgaggaaaaccaggca
gataattcagtcaacttcaaactctctctgctgtatgatgccgaaattcacataacaaga
tctaccaacataaatttttatgaagtctcctcggatgggaatattccttctattgtgaac
aattttgaagatattggtccgaaattcatcttctccattaaggtaacaacaggaagtgtt
ccagtcagcatggcatccgtgatcatccatatccctcaatacaccaaaggcaagaacccg
gtgatgtacctgactggggtgcacacggaccaggctggtgacatcagttgcaaagccgaa
ataaatccactgaagataggacaaacatcttcttctgtatctttcaagagtgaaaatttc
cgtcatgtaaaagaattgaactgcagaaccgcttcgtgtagtaacgtcacctgctggctg
aaagaccttcaggtgaaaggagaatacttccttaatgtgtctaccagaatttggaacggg
actttcgcagtatcgacttttcagacagtacagctgacagcagcggcagaaatagacacc
tataaccctcagatatatgcgatcgaagaaaacaccgtcacgattcccattaccataatg
aaacctcacgagaaagctcaagtaccaaccggagttatagtaggaagtgcaatcgctgga
atccttttgttattagctctggttgcgattttatggaagcttggattcttcaaaagaaaa
tatgaaaaaatgaccaaaaatccagatgaaattgatgagaccacagaactcaacagctga

KEGG   Physeter catodon (sperm whale): 102977938
Entry
102977938         CDS       T06011                                 

Gene name
ITGA4
Definition
(RefSeq) integrin alpha-4
  KO
K06483  integrin alpha 4
Organism
pcad  Physeter catodon (sperm whale)
Pathway
pcad04151  PI3K-Akt signaling pathway
pcad04510  Focal adhesion
pcad04512  ECM-receptor interaction
pcad04514  Cell adhesion molecules
pcad04640  Hematopoietic cell lineage
pcad04670  Leukocyte transendothelial migration
pcad04672  Intestinal immune network for IgA production
pcad04810  Regulation of actin cytoskeleton
pcad05135  Yersinia infection
pcad05140  Leishmaniasis
pcad05165  Human papillomavirus infection
pcad05410  Hypertrophic cardiomyopathy
pcad05412  Arrhythmogenic right ventricular cardiomyopathy
pcad05414  Dilated cardiomyopathy
Brite
KEGG Orthology (KO) [BR:pcad00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04151 PI3K-Akt signaling pathway
    102977938 (ITGA4)
  09133 Signaling molecules and interaction
   04512 ECM-receptor interaction
    102977938 (ITGA4)
   04514 Cell adhesion molecules
    102977938 (ITGA4)
 09140 Cellular Processes
  09144 Cellular community - eukaryotes
   04510 Focal adhesion
    102977938 (ITGA4)
  09142 Cell motility
   04810 Regulation of actin cytoskeleton
    102977938 (ITGA4)
 09150 Organismal Systems
  09151 Immune system
   04640 Hematopoietic cell lineage
    102977938 (ITGA4)
   04670 Leukocyte transendothelial migration
    102977938 (ITGA4)
   04672 Intestinal immune network for IgA production
    102977938 (ITGA4)
 09160 Human Diseases
  09166 Cardiovascular disease
   05410 Hypertrophic cardiomyopathy
    102977938 (ITGA4)
   05412 Arrhythmogenic right ventricular cardiomyopathy
    102977938 (ITGA4)
   05414 Dilated cardiomyopathy
    102977938 (ITGA4)
  09171 Infectious disease: bacterial
   05135 Yersinia infection
    102977938 (ITGA4)
  09172 Infectious disease: viral
   05165 Human papillomavirus infection
    102977938 (ITGA4)
  09174 Infectious disease: parasitic
   05140 Leishmaniasis
    102977938 (ITGA4)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:pcad04147]
    102977938 (ITGA4)
   04515 Cell adhesion molecules [BR:pcad04515]
    102977938 (ITGA4)
   04090 CD molecules [BR:pcad04090]
    102977938 (ITGA4)
Exosome [BR:pcad04147]
 Exosomal proteins
  Exosomal proteins of haemopoietic cells  (B-cell, T-cell, DC-cell, reticulocyte, and mast cell)
   102977938 (ITGA4)
  Exosomal proteins of other cancer cells
   102977938 (ITGA4)
Cell adhesion molecules [BR:pcad04515]
 Integrins
  Integrin alpha subunits
   102977938 (ITGA4)
CD molecules [BR:pcad04090]
 Proteins
  102977938 (ITGA4)
SSDB
Motif
Pfam: Integrin_alpha2 FG-GAP VCBS Integrin_alpha DUF11
Other DBs
NCBI-GeneID: 102977938
NCBI-ProteinID: XP_007114727
UniProt: A0A2Y9F5U9
LinkDB
Position
2
AA seq 1033 aa
MAAEARCGPGSRGAAVWKAVMLLLCLGVPTGRPYNVDTESALVYKGPADTLFGYSVVLHS
HGKNRWLVVGAPTASWLANTSVVNPGAIYRCRIGKNPERTCEQLQLGSPNGEPCGKTCLE
ERDNQWLGVTLSRQPGENGSIVTCGHRWKNIFYIKNENKLPTGVCYGMPSDLRTELSKRI
APCYQDYVRKFGENFASCQAGISSFYTEDLIVMGAPGSSYWTGSLFVYNITTNKYKAFLD
KHNQVKFGSYLGYSVGAGHFRSRHTTEVVGGAPQHEQIGKAYIFSIDAKELNILHEMKGK
KLGSYFGASICAVDLNADGFSDLLVGAPVQSTVREEGRVFVYINSGSGAVMNEMEIELTG
SDKYAARFGESIVNLGDIDNDGFEDVAIGAPQEDDLRGAIYIYNGRADGISSAFSQRIEG
LQISKSLSMFGQSISGQIDADNNGYVDVAVGAFRSDSAVLLRTRPVVIVEASLNHPESVN
RTNFNCIENELPSVCMDLTLCFSYKGKEVPGYIVLFYNMSLDVNRKAESPSRFYFSSNGT
SDVTTGSIKVSSRVANCKTHQAFMRKDVRDILTPIQIEATYHLGHHVISKRSTEEFPPLQ
PILQQKKEKDIIAKTINFARFCAHENCSADLQVSAKIGFLKPHENKTYLAVGSMKTLMLN
VSLFNAGDDAYETTLHIRLPTGLYFIKILDLEEKQINCEVTDSSGIVKLDCRVGYIYVDH
LSRTDISFLLDASSLSRAEEDLNITVHAACENEGETGNVKRNKVTLTVPLKYEVMLTVHG
FVNPTSFVYGPKEENEPEMCMAEKMNFTFHVINTGQSMAPNISVEIVIPNSFIPQTDKLF
NILDVQTTVGECHFKNYQRKCALEQKKGTMETLKDIFKFLSKTDKRLLYCMKADPHCLNF
SCNFGKMDSGKEASVHIQLEGRPSILEMDETRALKFEIRATAFPEPNPKVIELNKDENVA
HVLLEGLHHQRPKRHFTIAIILSSLLLGLTLLSLISYVMWKAGFFKRQYKSILQEENRRD
SWSYINSKSNKDD
NT seq 3102 nt   +upstreamnt  +downstreamnt
atggctgcggaagcgaggtgcgggccgggctcccgaggggccgccgtatggaaggcggtg
atgctactgctgtgcttgggagtcccgaccgggcgcccctacaacgtggacaccgagagc
gcgctggtttacaagggccccgccgacaccctgttcggctactcggtggtgctgcacagc
cacgggaagaaccgatggctcgtagtcggggcgcccacggccagctggctcgccaacact
tcagtggtcaatcctggggcgatttacagatgcaggattggaaagaacccagagcggacg
tgcgaacagctccagctgggtagccctaatggagaaccttgtggaaagacttgtttggag
gagagagacaatcaatggttgggggtcacgctttccagacagccaggagaaaatggctcc
atcgtgacttgtgggcatagatggaaaaatatattttacataaagaatgaaaataagctc
cccacgggtgtttgctatggaatgccctctgatttacgaacagagctgagtaaaagaata
gctccatgctatcaagattatgtgagaaaatttggagaaaattttgcatcatgtcaagct
ggaatatctagtttttacacagaggacttaattgtgatgggagctccaggatcatcctat
tggaccggctctcttttcgtctacaatataactacaaataaatacaaagcttttttagac
aaacacaatcaagtgaaatttggaagttatttaggatactcagttggagccggtcatttt
cggagtcgacacactaccgaagtagttggaggagcccctcaacatgaacagattggtaaa
gcatacatattcagcattgatgcaaaagaactaaatatcttacatgaaatgaaaggtaaa
aagcttgggtcttatttcggagcttctatctgtgccgtggacctcaacgcagatggcttc
tcagacctacttgtgggagctcccgtgcagagcaccgtcagggaggaaggaagggtgttt
gtgtacatcaactctggctctggagcagtaatgaacgaaatggaaatagagctcactgga
agtgacaaatatgctgccagatttggggaatctatagtcaatcttggcgacattgataat
gatggctttgaagatgttgctattggagctccacaggaagatgacttgcgaggtgctatt
tatatttacaatggccgagcagatgggatctcgtcagccttctcacagagaattgaaggg
cttcaaatcagcaaatcattaagtatgtttggacagtctatatctggacaaattgatgca
gataataatggatatgtagatgtagcagttggtgcttttcggtctgattctgccgtgctg
ctaaggacgagacctgtagtgattgtcgaagcttctttaaaccatcctgagtcagtaaat
agaacaaattttaactgtattgaaaatgaattgccttctgtgtgcatggatctaacactc
tgtttctcatataagggcaaagaggttccaggttatatcgttttgttttataacatgagc
ctggatgtgaaccgaaaggcagagtctccatcgagattttacttttcttccaatggaact
tcggatgtgactacaggaagcataaaagtatcaagcagagtggctaactgtaaaacacat
caagcatttatgcggaaagatgtacgggacatcctcaccccaattcagattgaagccact
taccacctggggcatcatgtcatcagtaaacgaagtacagaggaattcccaccacttcag
ccaattcttcagcagaagaaagaaaaagacatcattgcaaaaacaataaactttgcaaga
ttttgtgcccatgaaaactgttctgctgatttacaagtttctgcaaaaattggatttttg
aagccacatgaaaataaaacctatcttgctgttggaagtatgaagacattaatgttgaac
gtgtccttatttaatgccggagatgatgcatatgagacaactctgcatatcagactaccc
actggtctttacttcattaagattttagatctggaggagaaacaaataaactgcgaagta
acagacagctctggcatagtaaaacttgactgcagggttggttacatatatgtagatcat
ctgtcaaggacagatattagctttcttctggatgccagctcactcagcagagcagaagag
gatctcaacatcacagtgcatgccgcctgtgaaaatgaaggagaaacaggcaacgtgaaa
cgtaacaaagtgactttaacagtacctctcaagtatgaagtcatgctaactgttcatggg
tttgtaaacccaacttcgtttgtgtatggaccaaaggaggaaaatgagcctgaaatgtgc
atggcagagaaaatgaacttcactttccacgttatcaacactggccaaagcatggctcca
aatattagtgtggaaatagtgataccaaattcttttattccccaaactgataaactgttc
aacattttggatgtccagactactgttggagaatgccattttaagaattaccaaagaaag
tgtgcattagagcagaaaaaaggcacaatggagaccctgaaagatatattcaaattttta
tcaaagactgataagaggctactgtactgcatgaaagctgatccacattgtttaaatttc
tcatgcaattttgggaaaatggacagtggaaaagaagccagtgttcacattcagttggag
ggtcggccatccattttagaaatggatgagactagagccctgaagtttgaaataagagca
acagcttttccagagccaaatccaaaagttattgaactaaacaaggatgagaatgttgca
catgttctactcgaaggactacatcatcaaagacccaaacgccatttcactatagccatt
attttaagtagcttgctacttggacttactttactttcattgatttcatatgttatgtgg
aaggctggcttcttcaaaagacagtacaagtctatcctacaagaagaaaacagaagagac
agttggagttacattaacagtaaaagcaataaagatgattga

KEGG   Physeter catodon (sperm whale): 102978662
Entry
102978662         CDS       T06011                                 

Gene name
ITGA9
Definition
(RefSeq) integrin alpha-9 isoform X1
  KO
K06585  integrin alpha 9
Organism
pcad  Physeter catodon (sperm whale)
Pathway
pcad04151  PI3K-Akt signaling pathway
pcad04510  Focal adhesion
pcad04512  ECM-receptor interaction
pcad04514  Cell adhesion molecules
pcad04810  Regulation of actin cytoskeleton
pcad05165  Human papillomavirus infection
pcad05410  Hypertrophic cardiomyopathy
pcad05412  Arrhythmogenic right ventricular cardiomyopathy
pcad05414  Dilated cardiomyopathy
Brite
KEGG Orthology (KO) [BR:pcad00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04151 PI3K-Akt signaling pathway
    102978662 (ITGA9)
  09133 Signaling molecules and interaction
   04512 ECM-receptor interaction
    102978662 (ITGA9)
   04514 Cell adhesion molecules
    102978662 (ITGA9)
 09140 Cellular Processes
  09144 Cellular community - eukaryotes
   04510 Focal adhesion
    102978662 (ITGA9)
  09142 Cell motility
   04810 Regulation of actin cytoskeleton
    102978662 (ITGA9)
 09160 Human Diseases
  09166 Cardiovascular disease
   05410 Hypertrophic cardiomyopathy
    102978662 (ITGA9)
   05412 Arrhythmogenic right ventricular cardiomyopathy
    102978662 (ITGA9)
   05414 Dilated cardiomyopathy
    102978662 (ITGA9)
  09172 Infectious disease: viral
   05165 Human papillomavirus infection
    102978662 (ITGA9)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04515 Cell adhesion molecules [BR:pcad04515]
    102978662 (ITGA9)
Cell adhesion molecules [BR:pcad04515]
 Integrins
  Integrin alpha subunits
   102978662 (ITGA9)
SSDB
Motif
Pfam: Integrin_alpha2 FG-GAP VCBS FG-GAP_2 Integrin_alpha
Other DBs
NCBI-GeneID: 102978662
NCBI-ProteinID: XP_023988091
UniProt: A0A2Y9TB19
LinkDB
Position
18
AA seq 1035 aa
MGGPAARRGAGGLHALLLALVAAGSPAGAYNLDPQRPVRFQGPAGSFFGYAVLEHFHDNT
RWVLVGAPKADSKYSTSVKSPGAVFKCRVHTNPDRRCTELDMARGKNRGMPCGKTCREDR
DDEWMGVSLARQPKADGRVLACAHRWKNIYYETDHILPHGFCYIIPSNLQAQGRTLIPCY
EEYKKKYGEEHGSCQAGIAGFFTEELVVMGAPGSFYWAGTVKVLNLTDNTYFKLNDEVIM
NRRYTYLGYAVTAGHFSHVSTTDVVGGAPQDEGIGKVYIFRADRRSGTLIKIFQASGKKM
GSYFGSSLCAVDLNMDGLSDLLVGAPMFSEIRDEGQVTVYINRGNGALEEQLALNGDGAY
NAHFGESIASLGDLDDDGFPDVAIGAPKEDDFSGAVYIYHGDAGGMVPQYSMKLSGRKIS
PVLRMFGQSISGGIDMDGNGYPDVTIGAFMSDSVVLLRARPVITVDVSIFLPTSINITAP
QCHDGQQPVNCLNVTACFSFHGKHVPGKIGLNYVLTADMAKKEKSQLPRVYFVLLGESVG
QVSEKLQLVHLEATCHHYVAHVKRRVQDVISPIVFEAAYSLGEHVMGEEERELPALTPVL
RWKKGQKIAQKNQTVFERNCRSEDCAADLQLQGHLLLSSVDDRTPYLAMGAVKNISLNVS
ISNLGDDAYDANVSFNVSRELFFINMWQKEEMGISCELLESDFLKCSVGFPFMRSKSKYE
FSVIFDTSHLSGEEEVLCFIVTAQSGNMERSESLHDNILTLAVPLMHEVDTSITGIMSPT
SFVYGESVDASNFIQLEDLECHFQPLNVTLQVYNTGPSTLPGSSVSISFPSRLSPGGAEM
FHVQEMVVGQEKGNCSFQKNPTPCIIPQEPENIFHTIFAFFTKSGRKVLDCEKPGISCLT
MHCNLSALAKEESRTIDIYMLLNTEILKKDSSSVIQFMTRAKVKVDPALRVVEVASGNSE
EMTVVFEALHNLEPRGYVVGWIIAISLLVGILIFLLLAVLLWKMGFFRRRYKEIIEAEKN
RKENEDSWDWVQKNQ
NT seq 3108 nt   +upstreamnt  +downstreamnt
atgggcggcccggcggcgcggaggggcgccggggggctccacgcgctgctcctggcgctg
gtggccgcggggagccccgcgggcgcctacaatctggacccgcagcgccccgtgcgcttc
cagggtcccgccgggtcctttttcggctacgcggtgctggagcacttccacgacaacacg
cgctgggtccttgtgggtgcaccaaaggcagattccaagtacagcacttcagtgaagtcc
cctggggctgtgtttaagtgccgcgtccacaccaaccctgaccggagatgcaccgaactg
gacatggctcgagggaagaatcggggcatgccctgtggaaagacctgccgggaagacaga
gatgatgagtggatgggggtgagcctggcccggcagcccaaggctgatggccgcgtgctg
gcctgtgcccaccgctggaagaacatctactatgaaacagaccacatcctgccccacggc
ttctgttacatcatcccatccaacctccaggcccaaggcaggacgctgatcccttgctat
gaagagtataagaagaagtatggagaggaacacggctcctgccaggctgggatagcgggc
ttcttcactgaggagctggtggtgatgggtgccccagggtcattttattgggctgggacg
gtcaaagtgctgaacctcacagataacacctatttcaaactaaatgatgaagtgatcatg
aacaggaggtacacctacctgggttatgcagttactgccggacacttttctcacgtgtcc
accaccgatgtggtaggaggtgcccctcaggacgaaggcattgggaaggtttatattttt
agagctgaccgaagatcaggcaccttaattaagatttttcaggcatcaggtaaaaagatg
ggctcttacttcggctcctccttatgtgcagttgacctgaacatggacggcctctctgac
ctgctcgtgggggcccccatgttttctgagatcagggacgaagggcaggtcactgtctac
atcaacagaggaaacggagccctggaggagcagctggccctgaatggggatggagcctac
aatgcacactttggggagagcatcgccagcctgggcgacctcgatgatgacgggttccca
gatgtggccattggcgcacccaaggaggatgacttttcaggagcggtgtacatctatcac
ggtgatgccggtgggatggtccctcagtactccatgaaactttctgggcggaagataagt
ccggtcttgcggatgtttggtcagtccatatcaggaggcattgatatggatggaaatggc
tatcccgatgtaactattggagctttcatgtcggacagtgtggttctcctaagggcgaga
cccgtcatcacggtggatgtctccatcttcctccccacctccatcaacatcacggcgccc
cagtgtcacgacggccagcagcctgtgaactgcctgaatgtcaccgcctgctttagcttc
cacggcaagcacgttccgggaaaaataggcctgaattacgttctgacggctgatatggcc
aaaaaagaaaagagccagttgcccagggtctactttgtgttgctgggagagtccgtgggt
caggtctcagagaagctgcagctggtccatttggaggcgacatgtcatcattacgtggcc
cacgtgaagcggagagtgcaggacgtcatcagccccatcgtgttcgaggccgcctacagc
ctgggcgagcatgtgatgggagaggaggaaagggagctgccagccctgacccccgtgctc
cgctggaaaaagggacaaaagattgcacagaagaatcagactgtgtttgaaaggaattgc
cgatctgaggactgtgccgctgacctgcagcttcagggtcacctattactctccagtgtt
gatgacagaaccccatatctagctatgggggctgtgaagaatatctccctaaacgtctcc
atctccaacctcggggacgatgcctatgatgccaacgtgtccttcaacgtttcccgggag
ctcttcttcatcaacatgtggcagaaggaggaaatgggcatttcctgtgaactgctggaa
tcggacttcctcaaatgcagtgtgggattccctttcatgaggtcaaagtcgaagtatgaa
ttcagcgtgatctttgatacaagccacctgtctggggaagaggaagttctttgcttcatc
gttactgctcagagcggcaacatggagcgctcagagtccctgcacgacaacatcctcacg
ctggcggtgccactgatgcatgaggtggacacatccatcactggaatcatgtctccgacc
tcctttgtgtatggcgagtctgtggacgcatccaacttcattcagctggaagacctggag
tgtcatttccagcctctcaacgtcacccttcaggtctataacactgggccaagcaccctt
cctgggtcatctgtcagcatctctttccccagtcgcctgtcacctggaggagctgagatg
tttcatgtgcaggagatggtggtgggccaggagaagggaaactgttctttccagaaaaac
ccaaccccctgtatcatccctcaagaaccagaaaacatcttccatacaatatttgctttt
ttcacaaagtcgggaagaaaagtcttggactgcgaaaagccaggaatttcttgcctaaca
atgcactgtaatcttagtgcgctggctaaagaagaaagtcgtactatagacatttacatg
ctgctgaacacagaaatactgaagaaggacagttcatctgtcatccagttcatgacccgc
gccaaggtgaaggtggaccctgccctgagggtggtggaggtagccagtgggaactcagag
gagatgacggtggtcttcgaggcgttgcacaatctggagccccgaggctacgtcgtgggg
tggatcattgccatcagcttgctggtgggaatcctcatcttcctgctgctggctgtgctg
ctctggaagatgggcttctttcgcagaaggtacaaagaaattattgaagctgagaagaac
cgtaaagagaatgaagacagttgggactgggtccagaaaaaccagtga

KEGG   Physeter catodon (sperm whale): 102980052
Entry
102980052         CDS       T06011                                 

Gene name
ITGA7
Definition
(RefSeq) integrin alpha-7 isoform X2
  KO
K06583  integrin alpha 7
Organism
pcad  Physeter catodon (sperm whale)
Pathway
pcad04151  PI3K-Akt signaling pathway
pcad04510  Focal adhesion
pcad04512  ECM-receptor interaction
pcad04810  Regulation of actin cytoskeleton
pcad05165  Human papillomavirus infection
pcad05410  Hypertrophic cardiomyopathy
pcad05412  Arrhythmogenic right ventricular cardiomyopathy
pcad05414  Dilated cardiomyopathy
Brite
KEGG Orthology (KO) [BR:pcad00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04151 PI3K-Akt signaling pathway
    102980052 (ITGA7)
  09133 Signaling molecules and interaction
   04512 ECM-receptor interaction
    102980052 (ITGA7)
 09140 Cellular Processes
  09144 Cellular community - eukaryotes
   04510 Focal adhesion
    102980052 (ITGA7)
  09142 Cell motility
   04810 Regulation of actin cytoskeleton
    102980052 (ITGA7)
 09160 Human Diseases
  09166 Cardiovascular disease
   05410 Hypertrophic cardiomyopathy
    102980052 (ITGA7)
   05412 Arrhythmogenic right ventricular cardiomyopathy
    102980052 (ITGA7)
   05414 Dilated cardiomyopathy
    102980052 (ITGA7)
  09172 Infectious disease: viral
   05165 Human papillomavirus infection
    102980052 (ITGA7)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:pcad04147]
    102980052 (ITGA7)
   04515 Cell adhesion molecules [BR:pcad04515]
    102980052 (ITGA7)
Exosome [BR:pcad04147]
 Exosomal proteins
  Exosomal proteins of haemopoietic cells  (B-cell, T-cell, DC-cell, reticulocyte, and mast cell)
   102980052 (ITGA7)
Cell adhesion molecules [BR:pcad04515]
 Integrins
  Integrin alpha subunits
   102980052 (ITGA7)
SSDB
Motif
Pfam: Integrin_alpha2 FG-GAP VCBS DUF3488 Integrin_alpha
Other DBs
NCBI-GeneID: 102980052
NCBI-ProteinID: XP_007125755
UniProt: A0A2Y9FN19
LinkDB
Position
6
AA seq 1133 aa
MAGTPGRDPWGPPGICYLLGSLLAGLLFPGAVAFNLDVMGALRKEGEPGSLFGFSVALHR
QLQPGPQSWLLVGAPQALALPGQQANRTGGLFACPLSLEETDCYRVDIDRGADVQKESKE
NQWLGVSVRSQGPGGKIVTCAHRYEARQRVDQTLETRDVIGRCFVLSQDLAIRDELDGGE
WKFCEGRPQGHEQFGFCQQGTAAAFSPDSHYLLFGAPGTYNWKGTARVELCVQGSADLAH
LDDGPYEAGGEKELDPRLIPVPANSYFGFSIDSGKSLVRAEELSFVAGAPRANHKGAVVI
LRKDSASRLVPEVTLSGERLTSGFGYSLAVADLNNDGWTDLVVGAPYFFERQEELGGAVY
VYMNQGGHWAGVSPLRLCGSPDSMFGISLAVLGDLNQDGFPDLAVGAPFAGDGKVFIYHG
SSLGVVVKPSQVLEGEAVGIKSFGYSLSGGLDVDGNRYPDLLVGSLADTAVLFRARPVLH
VSHEVSILPRTIDLEQPNCASGHSVCMDLRVCFSYIASPSSYSPVVALDYTLDGDTDRRL
RGQVPRVTFLSRGPDDPKHQASGTVWLRRQHDRVCGDTMLQLQENVKDKLRAIVVTLSYS
LQTPRLRRQAPGQGLPPVAPILNAHQPSTQRTEIHFLKQGCGEDKVCQSNLRLVHARFCA
RVSDTEFQPLPMDADGTTALFALSGQPVIGLELKVTNLPSDPAQPQADGDDAHEAQLLVT
LPASLHYSGVRALDPAEKPLCLSNENASHVECELGNPMKRGAQVTFYLILSTSGITIETT
ELAVELLLATISEQELQPVSARARVFIELPLSITGVAIPQQLFFSGVVRGESAMQSERDV
GSKVKYEVTVSNQGQSLNTLGSAFLNIMWPHEIANGKWLLYPMRVELEGGRGPGQRGLCS
PRPNILHLDVDSRDRRRRELGQPEPQEPHEQPEPSTSWWPVSSAEKKKNVTLDCTRGTAS
CVVFSCPLYSFDRAAVLHVWGRLWNSTFLEEYSAVKSLEVIVQANITVKSSIKNLLLRDA
STVIPVMVYLDPAAVVAEGVPWWVILLAVLAGLLALALLVLLMWKMGFFKRARYPEATVP
QYHAVKIPREDRQQFKEEKTGTILRNNWGSPRREGPDAHPILAGDGHPVPGTA
NT seq 3402 nt   +upstreamnt  +downstreamnt
atggcagggactccgggccgcgatccatgggggccccctgggatttgttaccttcttggc
tccctgcttgccggactgctcttcccgggggctgtcgccttcaatctggacgtgatgggc
gccctgcgcaaggagggcgagccagggagcctctttggcttctctgtggctctgcatcgg
cagttgcagcccggaccccaaagctggctgctggtgggcgctccccaggctctggccctg
cctgggcagcaggcgaatcgcactggaggcctcttcgcttgccccctgagcctggaagag
actgactgctacagagtggacatcgaccggggagctgacgtgcaaaaggagagtaaggag
aaccagtggttgggagtcagtgttcggagccagggacctgggggcaagattgttacctgt
gcgcaccgatacgaggcgcggcagcgtgtggaccagaccctggagacgagggacgtgatt
ggtcgctgctttgtgctaagccaggacctggccatccgcgatgagctggatggcggggag
tggaagttctgtgagggacgcccccagggccacgaacaatttgggttctgccagcagggc
acggccgctgccttctcccccgacagccactacctcctctttggggccccaggaacctat
aactggaagggcacggccagggtggagctctgtgtgcagggctcagcggacctggcacat
ctggacgacgggccctacgaggcggggggtgagaaggagctggacccccgcctcatcccg
gtccctgccaacagctactttggtttctccatcgactcggggaagagtctggtgcgagca
gaggagctgagctttgtggcaggggccccccgtgccaaccacaagggtgctgtggtcatt
ctgcgcaaagacagcgccagtcgcctggtgcctgaagttacactgtccggggagcgcctg
acctccggctttggctactcgctggcagtggctgatcttaacaatgacggctggacagat
ctggtagtgggtgccccctacttctttgagcgccaagaagaactggggggtgccgtatat
gtgtacatgaaccaggggggtcactgggctggggtctcccctctccggctctgcggctct
cctgactccatgttcgggatcagtctggctgtcctgggggacctcaaccaagatggcttc
ccagaccttgctgtaggggctcccttcgccggggatgggaaagtctttatctaccatggg
agcagcctgggggttgtcgtcaaaccttcccaggtgctggagggcgaggctgtgggcata
aagagctttggctactctctgtcgggcggcctggatgtggatgggaaccgctacccggac
ctgctggtgggctccctggctgacactgccgtgctcttcagggccaggcccgtcctccac
gtctcccacgaggtctctattcttccaagaaccatcgacctagaacagcccaactgcgcc
agtggccactcggtctgcatggacctcagggtctgtttcagctacattgcatcgcccagc
agctacagccccgttgtggccctggattacacgttagatggggacacagaccggaggctc
cggggccaggtgccccgtgtgaccttcctgagccgtggcccggacgaccccaagcaccag
gcctcaggcaccgtgtggctgagacgccagcatgaccgagtctgtggagacactatgctt
cagcttcaggagaatgtcaaagacaagcttcgggccatcgtggtgactctgtcctatagt
ctccagacccctcggctccggcgacaggctcctggccaggggctgccccctgtggccccc
atcctcaatgcccaccagcccagcacccagcggacagagatccactttctgaagcaaggc
tgtggtgaagacaaggtgtgtcagagcaatctgcggctggtccacgcccggttctgcgcc
cgtgtcagcgacacggagtttcagcctctgcccatggatgcggatgggacgacagccctg
tttgcactgagtgggcagccagtcatcggcctggagctgaaggtcaccaatctgccttcg
gacccagcccagccccaggctgatggggatgacgcccatgaggcccagctcctggtcacc
ctccctgcctctctgcactattcaggagtccgggccctggaccctgcggagaagccgctg
tgcctgtccaatgagaacgcctcccatgttgagtgtgagctggggaaccccatgaagaga
ggtgcccaggtcaccttctacctcatccttagcacctcagggatcaccattgagaccaca
gagctggcggtggagctgctgttggccacgatcagcgagcaggagctgcagccggtctct
gcccgagcccgtgtcttcatcgagctgccactgtccatcacgggggtggccattccccag
cagctcttcttctccggcgtggtgcggggcgagagcgccatgcagtctgagcgggatgtg
ggcagcaaggtcaagtatgaggttacggtctccaaccaaggccagtcgctcaataccctg
ggctcggccttcctcaacatcatgtggccccacgagattgccaacgggaagtggctgctg
taccccatgcgggtggagctggagggcgggcgggggccggggcagaggggactctgttcc
cccaggcccaacatcctccacctggatgtggacagcagggacaggaggcggcgggagctg
gggcagccggagccgcaggagcctcatgagcagccggagcccagcacgtcctggtggcca
gtgtcctctgctgagaagaagaaaaacgtcaccctggactgcacccggggcacggccagc
tgcgtggtgttcagctgccctctctacagctttgaccgtgcagctgtgctgcacgtctgg
ggccgcctctggaacagcaccttcctggaggagtactcggctgtgaagtccctggaagtg
attgtccaagccaacatcaccgtgaagtcctccatcaagaacttgctgctcagagatgcc
tccacagtgatcccagtgatggtatacctggaccccgcggctgtggtggcagaaggagtc
ccctggtgggtcatccttctggctgtactggccgggctgctggcgctggcgctgctggtg
ctgctcatgtggaagatgggattcttcaagcgagcgcggtaccccgaagccactgtgccc
cagtaccacgcggtgaagatcccacgggaagaccggcagcagttcaaggaggagaagacg
ggcaccatcctgaggaacaactggggcagcccccggcgggagggccccgatgcacacccc
atcctggctggggatgggcaccctgtgccaggcactgcctag

KEGG   Physeter catodon (sperm whale): 102980851
Entry
102980851         CDS       T06011                                 

Gene name
ITGAV
Definition
(RefSeq) integrin alpha-V
  KO
K06487  integrin alpha V
Organism
pcad  Physeter catodon (sperm whale)
Pathway
pcad04145  Phagosome
pcad04151  PI3K-Akt signaling pathway
pcad04510  Focal adhesion
pcad04512  ECM-receptor interaction
pcad04514  Cell adhesion molecules
pcad04810  Regulation of actin cytoskeleton
pcad04919  Thyroid hormone signaling pathway
pcad05163  Human cytomegalovirus infection
pcad05165  Human papillomavirus infection
pcad05200  Pathways in cancer
pcad05205  Proteoglycans in cancer
pcad05222  Small cell lung cancer
pcad05410  Hypertrophic cardiomyopathy
pcad05412  Arrhythmogenic right ventricular cardiomyopathy
pcad05414  Dilated cardiomyopathy
pcad05418  Fluid shear stress and atherosclerosis
Brite
KEGG Orthology (KO) [BR:pcad00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04151 PI3K-Akt signaling pathway
    102980851 (ITGAV)
  09133 Signaling molecules and interaction
   04512 ECM-receptor interaction
    102980851 (ITGAV)
   04514 Cell adhesion molecules
    102980851 (ITGAV)
 09140 Cellular Processes
  09141 Transport and catabolism
   04145 Phagosome
    102980851 (ITGAV)
  09144 Cellular community - eukaryotes
   04510 Focal adhesion
    102980851 (ITGAV)
  09142 Cell motility
   04810 Regulation of actin cytoskeleton
    102980851 (ITGAV)
 09150 Organismal Systems
  09152 Endocrine system
   04919 Thyroid hormone signaling pathway
    102980851 (ITGAV)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    102980851 (ITGAV)
   05205 Proteoglycans in cancer
    102980851 (ITGAV)
  09162 Cancer: specific types
   05222 Small cell lung cancer
    102980851 (ITGAV)
  09166 Cardiovascular disease
   05418 Fluid shear stress and atherosclerosis
    102980851 (ITGAV)
   05410 Hypertrophic cardiomyopathy
    102980851 (ITGAV)
   05412 Arrhythmogenic right ventricular cardiomyopathy
    102980851 (ITGAV)
   05414 Dilated cardiomyopathy
    102980851 (ITGAV)
  09172 Infectious disease: viral
   05163 Human cytomegalovirus infection
    102980851 (ITGAV)
   05165 Human papillomavirus infection
    102980851 (ITGAV)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04131 Membrane trafficking [BR:pcad04131]
    102980851 (ITGAV)
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:pcad04147]
    102980851 (ITGAV)
   04515 Cell adhesion molecules [BR:pcad04515]
    102980851 (ITGAV)
   04090 CD molecules [BR:pcad04090]
    102980851 (ITGAV)
Membrane trafficking [BR:pcad04131]
 Endocytosis
  Phagocytosis
   Integrins (complement receptors)
    102980851 (ITGAV)
Exosome [BR:pcad04147]
 Exosomal proteins
  Exosomal proteins of haemopoietic cells  (B-cell, T-cell, DC-cell, reticulocyte, and mast cell)
   102980851 (ITGAV)
  Exosomal proteins of epithelial cells
   102980851 (ITGAV)
Cell adhesion molecules [BR:pcad04515]
 Integrins
  Integrin alpha subunits
   102980851 (ITGAV)
CD molecules [BR:pcad04090]
 Proteins
  102980851 (ITGAV)
SSDB
Motif
Pfam: Integrin_alpha2 FG-GAP VCBS Integrin_alpha LYRIC
Other DBs
NCBI-GeneID: 102980851
NCBI-ProteinID: XP_028335676
UniProt: A0A455AUW4
LinkDB
Position
2
AA seq 1012 aa
MASLPRRRLRLRPRRLLLLLPGFLLPLCGAFNLDVDSPAEYSGPEGSYFGFAVDFFVPSA
SSRMFLLVGAPKANTTQPGIVEGGQVLKCDWSSHHGCQPIEFDATGNRDYAKDDPLEFKS
HQWFGASVRSKQDKILACAPLYHWRTEMKQEREPVGTCFLQDGTKTVEYAPCRSSQLISD
QIAEIVSKYDPKVYSIKYNNQLATRTAQAIFDDSYLGYSVAVGDFNGDGIDDFVSGVPRA
ARTLGMVYIYDGKNMSSLHNFTGEQMAAYFGFSVAATDINGDDYADVFIGAPLFMDRGSD
GKLQEVGQVSVSLQRASGDFQTTKLNGFEVFARFGSAIAPLGDLDQDGFNDIAIASPYGG
EDKKGIVYIFNGRPTGLNAVPSQILEGKWAARSMPPSFGYSMKGATDIDKNGYPDLIVGA
FGVDRAVLYRARPVITVNAGLEVYPSILNQDNKTCPLPGTDLKVSCFNVRFCLKADGKGA
LPTKLNFQVELLLDKLKQKGAIRRALFLHNRSPGHSKNMTISRGGQMQCEELIAYLRDES
EFRDKLTPITIFMEYRLDYRTAADATGLQPILNQFTPANISRQAHILLDCGEDNVCKPKL
EVSVDSDQKKIYIGDDNPLTLIVKAQNQGEGAYEAELIVSIPPQADFIGVVRNSEALARL
SCAFKTENQTRQVVCDLGNPMKAGTQLLAGLRFSVHQQSEMDTSVKFDLQIQSSNLFDKV
SPVVSYKVDLAVLAAVEIRGVSSPDHIFLPIPNWEHKENPETEEDVGPVVQHIYELRNNG
PSSFSKAMLNLQWPYKYNNNTLLYILQYDIDGPMNCTSDMEINPLRIKISNSQTTEKNDT
IGGQGDRNHLITKRDLTLSEGDVHTLGCGIAECLKIVCQVGRLDRGKSAILYVKSLLWTE
TFMNKENQNHSYSLKSSASFNVIEFPYKNLPIEDIFNSTLVTTNVTWGIQPAPMPVPVWV
IILAVLAGLLLLAVLVFVMYRMGFFKRVRPPQEEQEREQLQPHENGEGNSET
NT seq 3039 nt   +upstreamnt  +downstreamnt
atggcttccctgccgcggcggcggctgcgccttcgcccccgccgcctcctgctccttctc
cccggattcctgctgcctctttgcggcgccttcaatctagatgtggacagccctgcggag
tactctggccccgagggtagttacttcggcttcgcggttgatttcttcgtgcccagcgcg
tcttccaggatgtttcttctggtgggagctcccaaagcaaacactacccagcctgggatt
gtggaaggagggcaagtcctcaagtgtgactggtcttctcaccatgggtgccagccaatt
gaatttgatgcaacaggcaatagagattatgccaaggatgatccgttggagtttaagtcc
catcagtggtttggagcatctgtgaggtcaaaacaggataaaattttggcctgtgcccca
ctgtaccactggaggactgaaatgaaacaggagagagagcctgttggaacatgctttctt
caggatggtacaaagactgttgagtatgctccatgcagatcaagtcagctcatttcagat
caaatagcagaaattgtatctaaatatgaccccaaagtttatagcatcaagtataataac
cagttagcaactcggactgcacaagctatttttgatgacagttatttgggttactcagtg
gccgtcggagatttcaacggtgatggcatagatgactttgtttcaggagttccaagagca
gcaaggactttgggaatggtttatatttatgatgggaaaaatatgtcctccttacacaat
tttactggtgaacagatggctgcatattttggattttctgtcgctgccactgacattaat
ggggatgattacgcagacgtatttattggagcacctctcttcatggatcgtggttctgat
ggcaaactccaggaggtggggcaggtctcagtgtctctgcaaagagcttcgggagacttc
cagacaaccaaactgaatgggtttgaggtctttgcaaggttcggcagtgccatagcccct
ttgggagatctggaccaggacggcttcaatgatattgcaattgcttctccatatgggggt
gaagataaaaaaggaattgtttatattttcaatggaagacccacaggcctgaatgcggta
ccatctcagatccttgaagggaagtgggctgctcggagcatgccaccaagcttcggctat
tcaatgaaaggagccacggatatagacaagaatggatatccagacttaattgtaggagct
tttggtgtagatagagctgtattatacagggccagaccagttatcactgtaaacgctggc
cttgaagtgtatcctagcattttaaatcaagacaataaaacctgcccactgcctgggaca
gatctcaaagtttcctgttttaatgtcaggttctgcttaaaggcagatggcaaaggagca
cttcccacgaaacttaacttccaggtggagcttcttttggataaactcaagcaaaaagga
gcaattcgacgagcactatttctccataacaggtccccgggtcactccaagaacatgacc
atctcaagggggggacagatgcaatgtgaagaactaatagcatatctgcgggatgaatct
gaatttagagacaaactcactccgattactatttttatggagtatcggttggattataga
acagctgctgatgcgacaggcttgcaacctattcttaaccaattcactcctgccaatatt
agtcgacaggctcatattctgcttgactgtggtgaagacaatgtctgtaaacccaaactg
gaagtttctgtagatagtgatcaaaagaagatctatattggggacgacaaccctctgacc
ttgattgttaaggctcagaatcagggggaaggtgcctatgaagctgagctcatcgtttcc
atcccaccgcaggccgatttcatcggggtggtccgcaacagtgaagctttagcaagactt
tcctgtgcctttaagacagaaaaccaaacccgccaggtggtatgtgaccttggaaaccca
atgaaggctggaactcaactcctagctggtcttcgtttcagtgtgcaccagcaatcagag
atggatacttccgtgaaatttgacttacaaatccaaagctccaatctttttgacaaagta
agcccggttgtatcttacaaagttgaccttgctgttttagctgctgttgagataagagga
gtctcaagtcctgatcatatctttcttccgattccaaattgggagcacaaggagaaccct
gagactgaagaagacgttgggccagttgttcagcacatctacgagctgagaaataacggt
ccgagttccttcagcaaggcaatgctaaatcttcagtggccttacaaatataacaataac
actttgttgtacatccttcaatatgatattgatgggccaatgaactgcacttcagatatg
gagatcaaccctttgagaattaagatctcaaattcacaaacaactgaaaagaatgacaca
attggtgggcaaggtgaccggaaccatctcatcactaagcgggatctcaccctcagtgaa
ggagatgtgcacactttgggttgtggaattgctgaatgcttgaagattgtctgccaggtg
gggcgactagacagaggaaagagtgcaatcctgtatgtaaagtctctactgtggactgag
acctttatgaataaggaaaaccagaatcattcatattctctgaagtcgtctgcttcattt
aatgtcatagagtttccttataagaaccttccaattgaggacatcttcaactccacatta
gttaccactaatgtcacctggggcattcagccggcacccatgcctgtacctgtgtgggtg
atcattttagcagttctagcaggattgttgttactggctgttttggtatttgtaatgtac
aggatgggcttctttaaacgtgtccggccacctcaagaagaacaagaaagggaacagctt
caacctcatgaaaatggtgaaggaaactcagaaacttaa

KEGG   Physeter catodon (sperm whale): 102982420
Entry
102982420         CDS       T06011                                 

Gene name
ITGA3
Definition
(RefSeq) integrin alpha-3 isoform X2
  KO
K06482  integrin alpha 3
Organism
pcad  Physeter catodon (sperm whale)
Pathway
pcad04151  PI3K-Akt signaling pathway
pcad04510  Focal adhesion
pcad04512  ECM-receptor interaction
pcad04640  Hematopoietic cell lineage
pcad04810  Regulation of actin cytoskeleton
pcad05165  Human papillomavirus infection
pcad05200  Pathways in cancer
pcad05222  Small cell lung cancer
pcad05410  Hypertrophic cardiomyopathy
pcad05412  Arrhythmogenic right ventricular cardiomyopathy
pcad05414  Dilated cardiomyopathy
Brite
KEGG Orthology (KO) [BR:pcad00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04151 PI3K-Akt signaling pathway
    102982420 (ITGA3)
  09133 Signaling molecules and interaction
   04512 ECM-receptor interaction
    102982420 (ITGA3)
 09140 Cellular Processes
  09144 Cellular community - eukaryotes
   04510 Focal adhesion
    102982420 (ITGA3)
  09142 Cell motility
   04810 Regulation of actin cytoskeleton
    102982420 (ITGA3)
 09150 Organismal Systems
  09151 Immune system
   04640 Hematopoietic cell lineage
    102982420 (ITGA3)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    102982420 (ITGA3)
  09162 Cancer: specific types
   05222 Small cell lung cancer
    102982420 (ITGA3)
  09166 Cardiovascular disease
   05410 Hypertrophic cardiomyopathy
    102982420 (ITGA3)
   05412 Arrhythmogenic right ventricular cardiomyopathy
    102982420 (ITGA3)
   05414 Dilated cardiomyopathy
    102982420 (ITGA3)
  09172 Infectious disease: viral
   05165 Human papillomavirus infection
    102982420 (ITGA3)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:pcad04147]
    102982420 (ITGA3)
   04515 Cell adhesion molecules [BR:pcad04515]
    102982420 (ITGA3)
   04090 CD molecules [BR:pcad04090]
    102982420 (ITGA3)
Exosome [BR:pcad04147]
 Exosomal proteins
  Exosomal proteins of haemopoietic cells  (B-cell, T-cell, DC-cell, reticulocyte, and mast cell)
   102982420 (ITGA3)
Cell adhesion molecules [BR:pcad04515]
 Integrins
  Integrin alpha subunits
   102982420 (ITGA3)
CD molecules [BR:pcad04090]
 Proteins
  102982420 (ITGA3)
SSDB
Motif
Pfam: Integrin_alpha2 FG-GAP VCBS
Other DBs
NCBI-GeneID: 102982420
NCBI-ProteinID: XP_007128601
UniProt: A0A2Y9FQM7
LinkDB
Position
Unknown
AA seq 1053 aa
MGPGPSRAARVLRPMLCALALMVATSDRVASAFNLDTRFLVVKEAGNPGSLFGYSVALHR
QTERQQRYLLLAGAPRDLAVPDGYTNQTGAVYLCPLTAHKDDCERMDIAEKSDPDHHIIE
DMWLGVTVASQGPAGRVLVCAHRYTQVLWSGSEDQRRMVGKCYVRGNDLELDPSDDWQTY
HNEMCNSNTDYLETGMCQLGASGGFTPNTVYFGAPGAYNWKGNSYMIQRKDWDLSEYSYK
DPEDQGNLYIGYTMQVGSAILHPTNTTIVTGAPRHQHVGAVFLLSQEAGGDLRRRQVLEG
RQVGAYFGSAIALADLNNDGWQDLLVGAPYYFERKEEVGGAIYVFMNQAGTSFPAHPSLL
LHGPSRSAFGFSVASIGDINQDGFQDVAVGAPFEGLGKVYLYHGSSRGLLRQPQQVIHGE
KLGLPGLATFGYSLSGQMDVDENFYPDLLVGSLSDHIVLLRARPVINILHRTLVARPSVL
DPALCTATSCVQVELCFAYNQSAGDPNYRRNITLAYTLEADRDRRPPRLRFARSQSAIFH
GFFSMPEMRCQTLELLLMDNVRDKLRPIVISMNYSLPLRMPERPRLGLRSLDAYPVLNQA
QALENHTEVQFQKECGPDNKCDSNLQMRAAFVSELGQQLSRLQYNRDFRKLLLSINLTNT
PSRERAGEDAHEALLTLAVPPALLLSSVRPPGACQANETMTVVCELGNPFKRNQRMELLI
AFEVIGVTLHTRELQAQLQLSTSSHQDDLWPMTLTLLVDYTLQASLSMASHRLQSFFGGT
VMGESGMKTVEDVGSPLKYEFQVGPVGEGLAALGTLVLGLEWPYEVSNGKWLLYPTEITV
HGNGSWHCRPPGDLVNPLNLTLSVPGDRPPSPQRRRRQLDPGGDQGPLPVTLAAAKKAKS
EIQLSCGSDHTRCVWLECQIPDAPVITNVTVQARVWNSTFIEDYKDFDRVRVASWATLFL
RTSVPTINMENKTVRFSVDIDSDLVEELPAEIELWLVLVAVSAGLLLLGLIILLLWKCGF
FKRARTRALYEAKRQKAEMKSQPSETERLTDDY
NT seq 3162 nt   +upstreamnt  +downstreamnt
atggggcccggccccagccgcgccgcccgcgtcctacgcccgatgctctgcgcgctcgcc
ttgatggtggccaccagcgaccgcgtcgcctccgccttcaacctggacacccgattcctg
gtggtgaaggaggccgggaacccgggcagcctcttcggctactcggtcgccctccatcgg
cagacggagcggcagcagcgctacctgctcctggctggcgccccccgcgaccttgctgtg
cctgatggctataccaaccagaccggtgctgtgtacctgtgcccactcactgcccacaag
gacgactgtgaacggatggacattgcagagaaaagtgaccctgaccatcacattattgag
gacatgtggctcggggtgactgtggccagccagggccctgcgggcagagtcctggtctgt
gcccaccgctacacccaggtgttgtggtcggggtcggaggaccagcggcgcatggtgggc
aagtgctatgtgaggggcaacgacctggagctggaccccagtgatgactggcagacctac
cacaacgaaatgtgcaatagcaacaccgactacctggagaccggcatgtgccagctgggc
gccagcggcggcttcaccccaaacactgtgtactttggcgctcccggtgcctacaactgg
aaaggaaacagctacatgattcagcggaaggactgggatttatccgaatatagttacaag
gacccagaggaccaaggcaacctctacatcggctacacgatgcaggtgggcagtgccatc
ctgcaccctacaaacaccaccattgtgacgggtgcccctcggcaccaacatgtgggcgct
gtctttttgctgagccaggaggcaggtggagacctgaggaggaggcaggtgctggagggc
aggcaggtgggcgcctatttcggcagcgccattgccctggcagacctgaacaatgatggg
tggcaggacctcctggtgggtgccccctattactttgagcggaaagaggaggtagggggt
gccatttatgtcttcatgaaccaggcaggcacctccttcccggcccacccctccctcctt
cttcacggccccagtcgctctgcctttggcttctccgtggcaagcatcggtgacatcaac
caggatggattccaggacgttgctgtgggagcccctttcgagggcttgggcaaagtgtac
ctctaccacggcagctccagggggctcctcagacagccccagcaggtaatacacggagag
aagctgggactgcctggcttggccaccttcggctactccctgagtgggcagatggatgtg
gatgagaacttctacccagacctgctggtggggagcctgtcagaccacatcgtgctgctg
cgggcccggcctgtcatcaacatcctccacaggaccttggtggccaggccatctgtactg
gatcccgcactctgcacagccacctcctgtgtgcaggtagagctgtgctttgcttacaac
cagagtgctggggaccccaactacaggcggaacatcaccctggcctacactctggaggcc
gaccgggaccgccgcccgccccggctccgctttgcacgcagtcagtcagctatcttccat
ggcttcttctccatgcccgagatgcgctgccagacgctggagctgctcctgatggacaac
gtccgtgacaaactccgacccatcgtcatctccatgaactactctttacctttgcggatg
cctgagcgcccccgactggggcttcggtccctggacgcctacccggtcctcaaccaggcg
caggctctggagaaccacacggaggtccagttccagaaggagtgcgggccggacaacaag
tgcgacagcaacttgcagatgcgggcggccttcgtgtctgagctggggcagcagctgagc
aggctccagtacaatagagactttcgaaaactgctgctgagcatcaacttgaccaacacc
ccgagccgggagcgggctggggaagacgcccacgaggcgctgctcaccctggcggtgcct
cccgccctgctgctgtcctcagtgcgcccccctggagcttgccaagccaacgagaccatg
accgtcgtttgcgagctggggaaccccttcaaacggaaccagaggatggagctgctcatt
gccttcgaggtcattggggtgaccctgcacacaagggagctccaggcacagctgcagctc
tccacgtcaagtcaccaggatgacctgtggcccatgaccctgactctgctggtggactac
acactccaggcctcgctcagcatggcgagtcaccggctacaaagcttctttggggggaca
gtgatgggtgagtctggcatgaaaactgtggaggatgtgggaagccctctcaagtatgag
ttccaggtgggcccagtgggggaagggctggcagcccttggtaccctggtcctggggctg
gagtggccctatgaagtcagcaatggcaagtggctgctgtaccccacggagatcacagtc
cacggcaatgggtcctggcactgccggccgcctggagaccttgtcaaccctctcaacctc
actctctctgttcctggggacaggccgccatctccacaacgcaggcggcgacagctggac
cccgggggagaccagggccccctgcccgtcactctggctgctgccaaaaaagccaagtct
gagatccagctgagctgtggcagtgaccacacccgctgtgtgtggctggagtgccagatt
cctgatgcccccgtcatcaccaacgtgacagtgcaggcacgagtgtggaacagcaccttc
atcgaggattacaaagactttgaccgagtcagggtagccagctgggccaccctgttcctc
cgaaccagcgtccccaccatcaacatggagaacaagacggtgcggttctccgtggacatt
gactctgacctggtggaggagctgccagccgagatcgagctgtggctggtgcttgtggct
gtgagtgccgggctgctgctgctggggctgatcatcctcttgctgtggaagtgcggcttc
ttcaagcgagcccgcactcgggccctgtatgaagctaagaggcagaaggcggagatgaag
agccagccatcagagacagagaggctgacggacgactactga

KEGG   Physeter catodon (sperm whale): 102983046
Entry
102983046         CDS       T06011                                 

Gene name
ITGA5
Definition
(RefSeq) integrin alpha-5
  KO
K06484  integrin alpha 5
Organism
pcad  Physeter catodon (sperm whale)
Pathway
pcad04145  Phagosome
pcad04151  PI3K-Akt signaling pathway
pcad04510  Focal adhesion
pcad04512  ECM-receptor interaction
pcad04640  Hematopoietic cell lineage
pcad04810  Regulation of actin cytoskeleton
pcad05100  Bacterial invasion of epithelial cells
pcad05133  Pertussis
pcad05135  Yersinia infection
pcad05165  Human papillomavirus infection
pcad05168  Herpes simplex virus 1 infection
pcad05205  Proteoglycans in cancer
pcad05206  MicroRNAs in cancer
pcad05410  Hypertrophic cardiomyopathy
pcad05412  Arrhythmogenic right ventricular cardiomyopathy
pcad05414  Dilated cardiomyopathy
Brite
KEGG Orthology (KO) [BR:pcad00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04151 PI3K-Akt signaling pathway
    102983046 (ITGA5)
  09133 Signaling molecules and interaction
   04512 ECM-receptor interaction
    102983046 (ITGA5)
 09140 Cellular Processes
  09141 Transport and catabolism
   04145 Phagosome
    102983046 (ITGA5)
  09144 Cellular community - eukaryotes
   04510 Focal adhesion
    102983046 (ITGA5)
  09142 Cell motility
   04810 Regulation of actin cytoskeleton
    102983046 (ITGA5)
 09150 Organismal Systems
  09151 Immune system
   04640 Hematopoietic cell lineage
    102983046 (ITGA5)
 09160 Human Diseases
  09161 Cancer: overview
   05206 MicroRNAs in cancer
    102983046 (ITGA5)
   05205 Proteoglycans in cancer
    102983046 (ITGA5)
  09166 Cardiovascular disease
   05410 Hypertrophic cardiomyopathy
    102983046 (ITGA5)
   05412 Arrhythmogenic right ventricular cardiomyopathy
    102983046 (ITGA5)
   05414 Dilated cardiomyopathy
    102983046 (ITGA5)
  09171 Infectious disease: bacterial
   05135 Yersinia infection
    102983046 (ITGA5)
   05133 Pertussis
    102983046 (ITGA5)
   05100 Bacterial invasion of epithelial cells
    102983046 (ITGA5)
  09172 Infectious disease: viral
   05168 Herpes simplex virus 1 infection
    102983046 (ITGA5)
   05165 Human papillomavirus infection
    102983046 (ITGA5)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:pcad04147]
    102983046 (ITGA5)
   04515 Cell adhesion molecules [BR:pcad04515]
    102983046 (ITGA5)
   04090 CD molecules [BR:pcad04090]
    102983046 (ITGA5)
Exosome [BR:pcad04147]
 Exosomal proteins
  Exosomal proteins of haemopoietic cells  (B-cell, T-cell, DC-cell, reticulocyte, and mast cell)
   102983046 (ITGA5)
Cell adhesion molecules [BR:pcad04515]
 Integrins
  Integrin alpha subunits
   102983046 (ITGA5)
CD molecules [BR:pcad04090]
 Proteins
  102983046 (ITGA5)
SSDB
Motif
Pfam: Integrin_alpha2 FG-GAP VCBS Integrin_alpha
Other DBs
NCBI-GeneID: 102983046
NCBI-ProteinID: XP_007125766
UniProt: A0A2Y9FKT9
LinkDB
Position
Unknown
AA seq 1103 aa
MPSRPPPRQAGGGLSREFGKLLPALSHSPLGGLGSGSGSVAPGQGRAGAMGSRAPGSALL
AVQLRWGPRRRPRLLPLLLLLLLLPPPPRVGGFNLDAEAPAVLSGPPGSFFGFSVDFYRP
GTDGVSVLVGAPKANTSQPGVLQGGAVYLCPWGTSPAQCTPIEFDSKGSRILESSPPSSL
EGEEPVEYKSLQWFGATVRAHGSSILACAPLYSWRTEKEPLSDPVGTCYLSTDNFTRILE
YAPCRSDFSQAAGQGYCQGGFSAEFTKTGRVVLGGPGSYFWQGQILSATQEQIAESYYPG
YLINPVQGQLQTRQASSIYDDSYLGYSVAVGEFSGDDTEDFIAGVPKGNLTYGYVTILNG
SDIRSLYNFSGEQMASYFGYAVAATDINGDGLDDLLVGAPLLMERTADGRPQEVGRVYIY
LQRPAGMEPMPTLTLTGHDEFGRFGSSLTPLGDLDQDGYNDVAIGAAFGGENQQGVVFVF
PGGPGGLASKPSQVLLPLWAAGHTPDFFGFALRGGRDLDGNGYPDLIVGSFGVDKAVVYR
GRPIVSASASLTIFPAMFNPEEHSCSLGGNPAACINLSFCLNASGKHVPDSIGFTVELQL
DWQKQKGGARRALFLASRQATLTQTLLIQNGAREDCREMKIYLRNESEFRDKLSPIHIAL
NFSLDPQAPVDSHGLRPVLHYQSKSRIEDKAQILLDCGEDNICVPDLQLEVFGEQNHVYL
GDKNSLNLTFHAQNVGEGGAYEAELRVTAPPEAEYSGLVRHPGNFSSLSCDYFAVNQSRL
LVCDLGNPMKAGASLWGGLRFTVPHLRDTKKTIQFDFQILSKNLNNSQSEVVSFQLSVEA
QAQVSLNGVSKPEAVLFPVSDWHPRDQPQEEGDVGPAVHHVYELINLGPSSISRGVLELS
CPQALEGQQLLYVTRVTGLSNCTTSHPPNPQGLELDPEGSQHHRLQRRDAPGRSPASSGP
QILKCPEAECFRLRCELGPLHRQESRSLLLHFRVWAKTFLQREHQPFSLQCEAVYEALKM
PYRILPRQLPRKELQVATAVQWIKAEGSHSVPLWIIILAILIGLLLLGLLIYILYKLGFF
KRSLPYGTAMEKAQLKPPATSDA
NT seq 3312 nt   +upstreamnt  +downstreamnt
atgccctcccgcccgcccccccggcaggcggggggagggctcagccgggagtttggcaaa
ctcctccccgcgttgagtcattcgcctctgggaggtttaggaagcggctccgggtcggtg
gccccaggacagggaagagcgggcgctatggggagccgggcgccagggtccgctctcctc
gccgtgcagctgcgctggggcccccggcgccgaccccggctgctgccgctgctgctgctg
ctgctgctgctgccgccgccgcccagggtcgggggcttcaacttagacgcggaggcccca
gcggtgctctctgggcccccgggctccttcttcggcttctcggtggacttttaccggccg
gggacagacggggtcagcgtgctggtgggagcgcccaaggctaacaccagccagccggga
gtgctgcagggcggtgccgtctacctctgcccctggggcaccagcccggcacagtgcacc
cccattgaatttgacagcaaaggctctcggatcctagagtcctcgccgccgtccagcctc
gagggagaggagcctgtggagtacaagtccctgcagtggttcggagcgacggtgcgagcc
catggctcctccatcttggcctgtgctcccctctacagctggcgcaccgagaaggagcct
ctgagcgatcctgtgggcacctgctatctctccacagacaacttcacccggattctggag
tatgcaccgtgccgctcagatttcagccaggcagcagggcagggttactgccaagggggc
ttcagtgccgagttcaccaagactgggcgtgtggtcctgggcggaccagggagctatttc
tggcaaggccagatcctgtccgccacccaggagcagattgcagaatcctattaccccggg
tacctgatcaacccagttcaggggcagctgcagactcgccaggccagttccatttacgat
gacagctacctgggatactctgtggctgtaggtgaattcagtggtgatgacacagaagac
ttcattgctggcgtgcccaaagggaacctcacctatggttacgtcaccatccttaatggc
tcagacatccggtccctctacaacttctcaggggaacagatggcctcctactttggctat
gcagtggctgccacagacatcaatggggacgggctggacgacttgctggtaggggcgccc
ctgctcatggagcgcacagccgacgggcggccgcaggaggtgggcagggtctacatctac
ctgcagcgcccggccggcatggagcccatgcccacccttaccctcactggccatgatgag
tttggtcgattcggcagctccctgacccccctgggggacctggaccaggatggctacaat
gatgtagccattggggcggcctttggtggggagaaccagcagggagtggtgtttgtattc
cctgggggcccagggggcctggcctctaagccttcccaggttctgctgcccctatgggca
gctggccacacgccggacttctttggcttcgcccttcgaggaggccgagacctggatggc
aacggataccctgatctgattgtggggtcctttggtgtagacaaggctgtggtgtacagg
ggtcgccccatcgtgtctgccagtgcctccctcaccatctttcccgccatgttcaaccca
gaggagcatagctgcagcctggggggcaaccctgcagcttgcatcaatctcagcttctgc
ctcaatgcttctggaaaacacgttcctgactccatcggcttcacggtggagctccagttg
gactggcagaagcagaagggtggagcgcggcgggcactgttcctggcctcccgacaggcc
accctgacccagaccctgctcatccagaacggggctcgggaggattgcagagagatgaag
atctacctcaggaacgagtcagagtttcgagacaaactctccccaattcacatcgccctc
aacttctccctggacccccaagcccctgtggacagccacggccttcggccagtcctacac
taccagagcaagagccgcatagaggacaaggctcagatcttgctggactgtggagaagac
aatatctgtgtgccagacctacagctggaagtgtttggggagcagaaccacgtgtacctg
ggcgacaagaactctctgaacctcactttccatgcccagaatgtgggtgagggcggcgcc
tacgaggcagagcttcgcgtcacggcccctccggaggctgagtactcaggactcgtcaga
catccagggaacttctccagcctgagctgtgactactttgctgtgaaccagagccgcctg
ctggtgtgtgacctgggcaaccccatgaaggcgggagccagtctctggggtggccttcgg
ttcacagtcccgcacctcagggacacgaagaaaaccatccagtttgacttccagatcctc
agcaagaatctcaacaactcgcaaagcgaagtggtttccttccagctctccgtggaagct
caggcccaggtctcccttaacggtgtctccaagcccgaggcagtgctattcccagtgagc
gactggcatccccgagaccagccacaggaggagggggacgtgggccctgctgtccaccac
gtctatgagctcatcaacctgggccccagctccattagccggggcgtgctggagctcagc
tgtccccaggctcttgaaggtcagcagctcctctacgtgaccagggtcacaggactcagc
aactgcaccaccagtcacccccccaacccacagggcctggagttggatcccgagggttcc
cagcaccaccggctgcaaagacgggatgctccaggccgaagccctgcctcctcagggcct
cagatcctgaaatgcccggaggccgagtgtttcaggctgcgctgtgagctggggccgctg
caccggcaagaaagccgaagtctgctactgcatttccgcgtctgggccaagaccttcctc
cagcgggaacaccagccatttagtctgcagtgtgaagctgtgtatgaagccctgaagatg
ccctaccgaatcctgcctcggcagcttccccgaaaggaactgcaggtggccacagctgtg
cagtggatcaaggcagaaggcagccacagcgtcccgctctggatcattatcctagccatc
ctcattggcctcctgctcctaggtctgctcatctatatcctctacaagctcggattcttc
aaacgctccctcccatacggcaccgccatggaaaaagctcagctcaagcctccagccacc
tctgatgcctga

KEGG   Physeter catodon (sperm whale): 102983262
Entry
102983262         CDS       T06011                                 

Gene name
ITGA10
Definition
(RefSeq) LOW QUALITY PROTEIN: integrin alpha-10
  KO
K06586  integrin alpha 10
Organism
pcad  Physeter catodon (sperm whale)
Pathway
pcad04151  PI3K-Akt signaling pathway
pcad04510  Focal adhesion
pcad04512  ECM-receptor interaction
pcad04810  Regulation of actin cytoskeleton
pcad05165  Human papillomavirus infection
pcad05410  Hypertrophic cardiomyopathy
pcad05412  Arrhythmogenic right ventricular cardiomyopathy
pcad05414  Dilated cardiomyopathy
Brite
KEGG Orthology (KO) [BR:pcad00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04151 PI3K-Akt signaling pathway
    102983262 (ITGA10)
  09133 Signaling molecules and interaction
   04512 ECM-receptor interaction
    102983262 (ITGA10)
 09140 Cellular Processes
  09144 Cellular community - eukaryotes
   04510 Focal adhesion
    102983262 (ITGA10)
  09142 Cell motility
   04810 Regulation of actin cytoskeleton
    102983262 (ITGA10)
 09160 Human Diseases
  09166 Cardiovascular disease
   05410 Hypertrophic cardiomyopathy
    102983262 (ITGA10)
   05412 Arrhythmogenic right ventricular cardiomyopathy
    102983262 (ITGA10)
   05414 Dilated cardiomyopathy
    102983262 (ITGA10)
  09172 Infectious disease: viral
   05165 Human papillomavirus infection
    102983262 (ITGA10)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04515 Cell adhesion molecules [BR:pcad04515]
    102983262 (ITGA10)
Cell adhesion molecules [BR:pcad04515]
 Integrins
  Integrin alpha subunits
   102983262 (ITGA10)
SSDB
Motif
Pfam: VWA Integrin_alpha2 FG-GAP VWA_2 VCBS FG-GAP_2
Other DBs
NCBI-GeneID: 102983262
NCBI-ProteinID: XP_007130837
UniProt: A0A2Y9FUG8
LinkDB
Position
4
AA seq 1167 aa
MEFPLIPHLFLPLMFLTGLCSPFNLDVHHPRLFPGPPEAEFGYSVLQHVGGGRRWMLVGA
PWDGPSGDRRGDVYRCPVGGSHNAPCAKGHLGDYPLGNSSRPAVNMHLGMSLLETAGDGG
FMACAPLWSRACGSSVFSSGICARVDASFRPQGSLAPTVQRCPTYMDVVIVLDGSNSIYP
WSEVQTFLRRLVGRLFIDPEQIQVGLVQYGESSVHEWSLGDFRTKEEVVRAARNLSRREG
RETKTAQAIMMACTEGFSQSRGGRPEAARLLVVVTDGESHDGEELPTALKACEAGRVTRY
GIAVLGHYLRRQRDPSSFLREIRAIASDPDERFFFNVTDEAALTDIVDALGDRIFGLEGS
HGENESSFGLEMSQIGFSTHRLKDGILFGMVGAYDWGGSVLWLEGGRRLFPPRTALEDEF
PPALQNHAAYLGYSVSSMLLRGGRRLFLSGAPRFRHRGKVIAFQLKKDGAVRVAQSLQGE
QIGSYFGSELCPLDMDGDGTTDVLLVAAPMFLGPQNKETGRVYVYLVGQQSLLTLQGTLQ
PEPPQDARFGFAMAALPDLNQDGFADVAMGAPLEDGHRGALYLYHGTQSGVKPHPAQRIA
AVSMPHALSYFGRSVDGRLDLDGDDLVDVAVGAQGAAILLSSRPIVHLAPSLDVTPSAIS
VVQRDCKRRSQEAACLSAALCFQVTSRTPGRWDRQFHVRFTASLDEWTAGARAAFDGSGQ
RLSRRRLRLSVGTLTCEPLHFHVLDTSDYLRPVALTVTFALDNTTKPGPVLDEGSPTSIR
KLVPFSKDCGPDNECVTDLVLRANMDIRGSRKDPFVVRGGRRKVLVSATLENRKENAYNT
SLSLSFSRNLHLSSFIPQGYGPAKVECAAPSPHARLCSVGHPVFQAGAKVTFLLEFEFSC
SFLLSQVLVRLTASSNSLERNGTLHDNTAQTSAYIQYEPHLLFSSESTLHRYEVHPYGTL
PVGPGPEFKTTLRVQNLGCYVVSGLIISALLPAVAHGGNYFLSLSQVITNNASCTVQNLT
EPPEPPVHPEELQHTSWLNGNNSRCQVMRCHLGRLAKGTEVSVGLLRLVHNEFFRRAKFK
SLTVVSTFELGTEEGSVLQLTEASRWSESLLEVIQSRPVLISLWTLIGSVLGGLLLLALL
VFCLWKLGFFARKKIPEEEKREEKLEQ
NT seq 3504 nt   +upstreamnt  +downstreamnt
atggagttccccctcatcccccacctgttcttgcccttgatgttcctgacaggtctctgc
tccccctttaacctggacgtgcaccacccacgcctatttccagggccaccggaggctgaa
tttggatacagtgtcttacaacatgttgggggtggacgccgatggatgttggtgggtgcc
ccctgggatgggccttcaggtgaccgaaggggggatgtttatcgctgccctgtagggggc
tcccacaatgccccatgtgccaagggccacttgggtgactatccactaggaaattcatct
cgtcctgctgtgaatatgcacctggggatgtctctcctggagacagctggtgatggggga
ttcatggcttgtgcccctctctggtctcgtgcttgtggctcatctgtcttcagttctggg
atatgtgcccgtgtagatgcttcgttccggccccagggaagcctggcacccactgtacaa
cgctgccccacatacatggatgtcgtcattgtgttggatggctccaacagcatctacccc
tggtctgaagttcagaccttcctgcgaagactagtagggagattatttattgacccggag
cagatacaggtgggactggtacagtatggggagagctctgtacatgagtggtccctggga
gatttccgaaccaaagaagaagtggtgagagcagcaaggaacctgagccggcgggaggga
cgagaaacaaagactgctcaagcaataatgatggcctgcacagaaggattcagtcagtcc
cgtgggggccgaccagaggctgccaggctactggtggttgtcactgatggagagtcacat
gatggagaggaacttcctacagcactaaaggcctgtgaagctggaagagtgacacgctat
gggattgcggtccttggtcactacctccggcggcagcgagaccccagctctttcctgcgg
gaaatcagagctattgccagtgatccagatgagagattcttcttcaatgtcacagatgaa
gcagcactgactgacattgtggatgcattaggggaccggatttttggccttgaggggtcc
cacggagaaaatgaaagctcctttgggctggaaatgtctcagattggtttctctactcat
cggctaaaggatgggattctcttcgggatggtaggggcttatgactgggggggctcagtg
ttatggcttgaaggaggtcgccgcctcttcccgccacggacggccctggaagatgagttc
ccccctgcattgcagaaccatgcagcctacctgggttactctgtttcctccatgcttttg
cggggtggacgccgcctctttctttcaggagctcctcggtttagacatcgaggaaaggtc
atcgccttccagcttaagaaagatggggctgtgagggtcgcccagagcctccagggagag
cagattggctcgtactttggcagtgagctctgcccattggatatggatggggatggaaca
actgatgtcttgcttgtggctgcccccatgttcctggggccccagaacaaggagacagga
cgtgtttatgtgtatctggtgggccagcagtccttgctgacgctccagggaacacttcag
ccagaacccccacaggatgctcgatttggctttgccatggctgcccttcctgatctgaac
caagatggttttgctgatgtggctatgggagcgcccctggaggatgggcaccgtggagca
ctgtacctctatcacgggacccagagtggagtcaagccccatcctgcccagcggattgct
gctgtctccatgccacatgccctcagctactttggccgaagtgtggatggccggttagat
ctggatggagatgacctggtagatgttgctgtgggtgcccaaggggcagccatcctgctc
agctcccggcccattgttcacctggccccttcactggatgtgaccccgtcggccatcagt
gtggttcagagggactgcaagcgacgcagccaggaggcagcctgcctatccgcagccctt
tgcttccaagtgacctcccgcactcccggccgctgggatcgccaattccatgtgcggttc
acagcatcgctggatgagtggacagctggggcccgtgcagcgtttgacggctctggccag
aggctgtcccgtaggcggctccggctcagtgtggggactctcacttgtgagccgttgcac
ttccatgtgctggatacatcagattacctccggccagtggccttgactgtgacctttgct
ttggacaacaccacaaagccagggcctgtgctggatgagggctcacccacctccatacga
aagctggtccccttctcgaaggactgtggccctgacaatgaatgtgtcacagatctggta
cttcgagctaatatggacatcagaggctccaggaaggacccattcgtggttcgaggtggt
cgacggaaagtgctggtgtcagcaactctggagaacaggaaggaaaatgcctacaacact
agcctgagtctcagcttctccagaaaccttcacctgtccagttttattcctcaggggtac
gggccagcgaaggtggagtgtgcagccccttcccctcatgcccgcctctgcagcgtgggg
catcctgtcttccaggctggagccaaggtgacctttctgctagagtttgagtttagctgc
tccttcctcctgagccaggtccttgtgaggctgactgccagcagcaatagcctggagaga
aatggcacgcttcatgataacacagcccagacctcagcctacatccagtatgagcctcac
ctcctattctctagtgagtccactctgcaccgctatgaggttcacccatatgggaccctc
ccagtgggccctggccctgaattcaaaaccactcttagggttcagaaccttggctgctat
gtggtcagtggcctcatcatctcagccctccttccagctgtggcccacgggggcaattac
ttcctgtcactgtctcaagtcatcactaacaatgcaagctgcacagtgcagaacctgact
gagcccccagagccccctgtgcatccagaggagcttcagcacacaagctggctgaatggg
aacaattcccggtgtcaggtcatgaggtgccaccttgggcgactggcaaaggggactgag
gtctctgttggactactgaggctggttcacaatgaatttttccgaagggccaaattcaag
tctctgacagtggtcagcaccttcgagctgggaactgaggagggcagtgtcctacagctg
actgaagcctcccgttggagtgagagcctcctggaggtgattcagtcccgccctgtcctc
atctccctgtggaccctcattggcagcgtcctgggggggctgcttctgcttgctctcctt
gtcttctgcctttggaagcttggcttctttgcccgtaagaaaatccccgaggaagaaaaa
agagaggagaaattggagcaatga

KEGG   Physeter catodon (sperm whale): 102990518
Entry
102990518         CDS       T06011                                 

Gene name
ITGA8
Definition
(RefSeq) integrin alpha-8 isoform X1
  KO
K06584  integrin alpha 8
Organism
pcad  Physeter catodon (sperm whale)
Pathway
pcad04151  PI3K-Akt signaling pathway
pcad04510  Focal adhesion
pcad04512  ECM-receptor interaction
pcad04514  Cell adhesion molecules
pcad04810  Regulation of actin cytoskeleton
pcad05165  Human papillomavirus infection
pcad05410  Hypertrophic cardiomyopathy
pcad05412  Arrhythmogenic right ventricular cardiomyopathy
pcad05414  Dilated cardiomyopathy
Brite
KEGG Orthology (KO) [BR:pcad00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04151 PI3K-Akt signaling pathway
    102990518 (ITGA8)
  09133 Signaling molecules and interaction
   04512 ECM-receptor interaction
    102990518 (ITGA8)
   04514 Cell adhesion molecules
    102990518 (ITGA8)
 09140 Cellular Processes
  09144 Cellular community - eukaryotes
   04510 Focal adhesion
    102990518 (ITGA8)
  09142 Cell motility
   04810 Regulation of actin cytoskeleton
    102990518 (ITGA8)
 09160 Human Diseases
  09166 Cardiovascular disease
   05410 Hypertrophic cardiomyopathy
    102990518 (ITGA8)
   05412 Arrhythmogenic right ventricular cardiomyopathy
    102990518 (ITGA8)
   05414 Dilated cardiomyopathy
    102990518 (ITGA8)
  09172 Infectious disease: viral
   05165 Human papillomavirus infection
    102990518 (ITGA8)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04515 Cell adhesion molecules [BR:pcad04515]
    102990518 (ITGA8)
Cell adhesion molecules [BR:pcad04515]
 Integrins
  Integrin alpha subunits
   102990518 (ITGA8)
SSDB
Motif
Pfam: Integrin_alpha2 FG-GAP VCBS Integrin_alpha LYRIC
Other DBs
NCBI-GeneID: 102990518
NCBI-ProteinID: XP_023972148
UniProt: A0A2Y9S0K4
LinkDB
Position
11
AA seq 1062 aa
MSARARRGPRGNRAPPLAPLCCFSAALAVLWSPASRAFNLDVDRLTVYGGPEGSYFGYAV
DFHVPAARTASVLVGAPKANTSQPDIVEGGAVYYCPWPAEGSVQCRQIPFDNTNNRKIRV
NGTKEPIEFKSNQWFGATVKAHKGKVVACAPLYHWRTLKPSPEKDPVGTCYVAIQNFSAY
AEYSPCRNSNADPEGQGYCQAGFSLDFYKNGDLIVGGPGSFYWQGQVITASIADIIANYS
FKDILRKLAGEKQTEVAPASYDDSYLGYSVAAGEFTGDSQQELVAGVPRGAQNFGCVSII
NSTDMTFIQNFTGEQMASYFGYTIAVSDVNNDGMDDILIGAPLFMEREFESNPREVGQVY
LYLQVNVLVFRNPQILAGTDVFGRFGSALAHLGDLNQDGYNDIAIGAPFAGKDQRGKVLI
YNGNKNGLNAKASQILQGVWASQAVPSGFGFTLRGDSDIDKNDYPDLIVGAFGTGKVAVY
RARPVVTVGAQLLLHPVIINLENKTCQIPESMASVACFSLQVCASVAGQSISNTIGLTAE
VQLDSLKQKGAIKRTLFLDNHQSHLVFPLVIKGQQSLQCQDFIVYLRDETEFRDKLSPIN
ISLNYSLDESTFKEGLEVKPILNYYRENVVTEQAHILVDCGDDNMCIPDLKLSARPDKHQ
VIIGDENHLMLIINARNEGEGAYEAELFVIIPEEADYVGIERSNKALRPLSCEYKMDNVT
RMVVCDLGNPMMAGTNSSLGLRFAVPRLEKTNISINFDLQIRSSNKDNADSNFVSLQINI
SAVAQVEIRGVSHPPQIVLPIRNWEPEEEPRKEEGVGPLVEHIYELHNIGPSTISDTLLE
VGWPFSARDEFLLYIFHIQTLGPLRCQTNPDINPQDIKPAAPPEDTPELSAFLRNSTIPH
LVRKRDVPALEPHRQSPAKILNCTNIECLQISCAVGQLGGGESAVLKVRSRLWAKTFLQR
KNDPYSLASLVSFEVKKMPYKDQPAKLPEGSIAIKTSVIWATPNVSFSIPLWVIILAILL
GLLVLAILTLALWKCGFFDRARPPQDDMNDREQLTNEKTPEA
NT seq 3189 nt   +upstreamnt  +downstreamnt
atgtccgcccgggcccgccgcggtccccggggcaaccgggcgccgcccctcgcgcccctc
tgctgtttctcggccgcgctggcggtgctgtggtcgcccgcctcgcgggcgttcaacttg
gacgtggaccggctcacggtgtacggcggccccgagggcagctacttcggctacgcggtg
gacttccacgtacctgccgctcgcacagcgagtgtcttggtgggagcgcccaaagccaac
accagccagccggacatcgtggaaggaggagccgtctactactgtccttggcccgccgag
gggtccgtgcagtgcaggcagataccgttcgacaacaccaacaacagaaagatcagagta
aatggaaccaaggaacctatagagtttaaatcgaatcaatggtttggagcaacagtgaaa
gctcataaaggaaaagtggtggcctgtgctccattatatcactggagaactcttaaaccg
tcgccagaaaaggacccagttggcacttgctatgtagcaattcagaatttcagtgcgtat
gctgagtactctccttgtcggaacagcaatgctgatcctgaaggtcagggttactgccaa
gcaggatttagtctggacttttataagaatggagaccttatagttggaggccctggcagt
ttttattggcaaggtcaggtgatcactgccagtattgcagatatcattgcaaactactca
ttcaaggacatcctgagaaaactggctggagaaaagcagacagaagtggctcctgcttcc
tacgatgacagttaccttggatattccgttgctgctggggaatttactggggactcccag
caagaattggttgctggggttcccagaggagcacagaattttggatgcgtttcaatcatt
aactctacagatatgacctttattcagaatttcactggtgaacagatggcatcttacttt
ggatatacaattgcagtatcagatgttaacaatgatggaatggatgacatattgatcggg
gcacctctctttatggaacgtgaatttgagagcaaccccagagaagtagggcaagtttac
ctgtatttgcaagtgaacgtgctggtcttcagaaatccgcagatcctcgcaggcactgac
gttttcgggagattcggtagtgctttggcccatttaggagacctgaaccaagatggatac
aatgacattgccatcggcgcgccctttgcaggcaaggaccaaagaggcaaagtgctcatt
tacaatggtaacaagaatggcttaaacgccaaggcttcccaaattctgcaaggagtgtgg
gcctcacaggctgtcccttctggattcggctttactttaagaggagattctgacatagac
aagaatgactacccagatttgattgtgggtgcatttggaacaggaaaagtagctgtttac
agagcgaggccggtcgtgacggtgggagcccagcttctcctgcacccggtgatcatcaat
ctggaaaataaaacctgccagattccagaatcgatggcatctgtggcctgcttttcttta
caagtgtgtgcatctgtggcgggccagagcatttcaaacacgataggcctgactgccgag
gtgcaattagattccctgaaacaaaaaggagccattaaacgcacgctcttcctagataac
catcagtcacatctcgtcttccctctcgtgataaaggggcagcagtccctccaatgccag
gattttatcgtttaccttcgagatgaaactgaattccgagataaattgtctccaatcaac
attagtttgaattacagtttggatgaatccacctttaaagaaggtctggaggtgaaacca
atattgaattactacagggaaaacgttgttacggaacaggctcacatcctggtcgactgt
ggagacgataacatgtgcattcctgacttgaagctgtcagctagaccagataagcatcag
gtcatcattggagatgaaaaccaccttatgctcataatcaacgcgagaaatgaaggggaa
ggtgcctacgaagccgagctctttgtgataattccagaagaggctgattatgttgggatt
gaacgcagcaacaaggcattgcgaccactgagctgtgagtacaagatggacaatgtcacc
cgaatggtggtgtgtgaccttgggaaccctatgatggctggaacaaactcttctctgggc
ctccgatttgcagttccacgacttgagaaaacaaacataagcattaacttcgatctccaa
atcagaagttccaacaaggacaacgcagacagcaattttgtgagcctgcaaatcaacatc
agtgctgtagctcaagtagaaataagaggggtatcccaccctccgcagatcgtcctgccc
attcgtaactgggaaccggaggaggagccccgcaaggaggagggagttggaccactggtg
gaacatatttatgagctgcacaatattggaccaagcaccatcagtgatacccttctggag
gtgggctggcccttctctgcccgggatgaatttctcctctacatttttcatattcaaact
ctgggacctctgcgatgtcaaacaaatcctgatatcaacccacaggatataaagcccgct
gcgccccccgaagacacccccgagctgagcgcctttttgagaaactccaccatccctcat
ctggtcaggaagagagacgtgcctgcgctggagcctcacagacagagccccgcaaagatc
ctgaattgtacaaatatcgagtgcttacaaatctcctgtgcagtgggacaactaggagga
ggagaaagcgctgtcctgaaagtcaggtcacggttatgggccaagacgtttctccagagg
aaaaatgacccctattctcttgcatccctggtgtcctttgaagttaagaagatgccttat
aaagatcagccagccaaactccctgaaggcagcatagcaattaaaacatcggttatttgg
gcaaccccaaatgtttccttctcgatcccgttgtgggtaataatactagcaatacttctt
ggattattggttctggccattttaaccttggctttatggaagtgcggattctttgaccga
gcaagacccccccaggatgatatgaatgacagggaacagctgaccaatgagaaaacccct
gaggcgtga

KEGG   Physeter catodon (sperm whale): 102993444
Entry
102993444         CDS       T06011                                 

Gene name
ITGA6
Definition
(RefSeq) integrin alpha-6 isoform X1
  KO
K06485  integrin alpha 6
Organism
pcad  Physeter catodon (sperm whale)
Pathway
pcad04151  PI3K-Akt signaling pathway
pcad04510  Focal adhesion
pcad04512  ECM-receptor interaction
pcad04514  Cell adhesion molecules
pcad04640  Hematopoietic cell lineage
pcad04810  Regulation of actin cytoskeleton
pcad05145  Toxoplasmosis
pcad05165  Human papillomavirus infection
pcad05200  Pathways in cancer
pcad05222  Small cell lung cancer
pcad05410  Hypertrophic cardiomyopathy
pcad05412  Arrhythmogenic right ventricular cardiomyopathy
pcad05414  Dilated cardiomyopathy
Brite
KEGG Orthology (KO) [BR:pcad00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04151 PI3K-Akt signaling pathway
    102993444 (ITGA6)
  09133 Signaling molecules and interaction
   04512 ECM-receptor interaction
    102993444 (ITGA6)
   04514 Cell adhesion molecules
    102993444 (ITGA6)
 09140 Cellular Processes
  09144 Cellular community - eukaryotes
   04510 Focal adhesion
    102993444 (ITGA6)
  09142 Cell motility
   04810 Regulation of actin cytoskeleton
    102993444 (ITGA6)
 09150 Organismal Systems
  09151 Immune system
   04640 Hematopoietic cell lineage
    102993444 (ITGA6)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    102993444 (ITGA6)
  09162 Cancer: specific types
   05222 Small cell lung cancer
    102993444 (ITGA6)
  09166 Cardiovascular disease
   05410 Hypertrophic cardiomyopathy
    102993444 (ITGA6)
   05412 Arrhythmogenic right ventricular cardiomyopathy
    102993444 (ITGA6)
   05414 Dilated cardiomyopathy
    102993444 (ITGA6)
  09172 Infectious disease: viral
   05165 Human papillomavirus infection
    102993444 (ITGA6)
  09174 Infectious disease: parasitic
   05145 Toxoplasmosis
    102993444 (ITGA6)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:pcad04147]
    102993444 (ITGA6)
   04515 Cell adhesion molecules [BR:pcad04515]
    102993444 (ITGA6)
   04090 CD molecules [BR:pcad04090]
    102993444 (ITGA6)
Exosome [BR:pcad04147]
 Exosomal proteins
  Exosomal proteins of haemopoietic cells  (B-cell, T-cell, DC-cell, reticulocyte, and mast cell)
   102993444 (ITGA6)
  Exosomal proteins of breast milk
   102993444 (ITGA6)
Cell adhesion molecules [BR:pcad04515]
 Integrins
  Integrin alpha subunits
   102993444 (ITGA6)
CD molecules [BR:pcad04090]
 Proteins
  102993444 (ITGA6)
SSDB
Motif
Pfam: Integrin_alpha2 FG-GAP VCBS LRR19-TM DUF4381 Integrin_alpha
Other DBs
NCBI-GeneID: 102993444
NCBI-ProteinID: XP_023977950
UniProt: A0A2Y9SNK6
LinkDB
Position
2
AA seq 1091 aa
MAAAGRLWLLYLSAGLLPRLGAAFNLDTREDNVIEKTGDSGSLFGFSLAMHWQLQPEDKR
LLLVGAPRAVALPLQKANRTGGLYSCDITSRGPCPRIEFDNDADPSSESKEDQWMGVTVQ
SQGPGGKVVTCAHRYEKRQHVNTKQESRDIFGRCYVLSQNLRIEDDMDGGDWSFCDGRLR
GHEKFGSCQQGVAATFTKDFHYIAFGAPGTYNWKGIVRVEQKNNTFFDMNIFEDGPYEVG
GETDHDESLVPVPANSYLGFSLDSGKGIVSKDEITFVSGAPRANHSGAVVLLKRDLKSAH
LLPEHIFDGEGLASSFGYDVAVVDLNKDGWQDIVIGAPQYFDRSGEVGGAAYVYINQQGR
WNNVKPIRLNGTKDSMFGIAVKNIGDINQDGYPDIAVGAPYDGKGKVFVYHGSANGINTK
PTQILEGKSPFFGYSIAGNMDLDRNSYPDVAVGSLSDSVTIFRSRPVINIQQTITVTPNR
IDLHQKMPCGAPSGICLKVKACFEYTAKPTGYNPSITIAGTLEAEKERRKSGLSSRVQFR
NQGSEPKYTQELTLSRQKQKMCMEETFWLQENIRDKLRPIPITASVEIQEPSTRRRVNSL
PEVLPILNSNEPKSVHTDVHFLKEGCGDDNVCNSNLKLEYKFCTREGSQDKFSYLPIQKG
VPELVLKDQKDIALEITVTNSPSNPKNPTKDGDDAHEAKLIATFPDTLTYSAYRELKAFP
EKQLSCVANQNGSQADCELGNPFKRNSSVTFYLILSTSEITFDTTDLDINLKLETTSNQD
NLASITATARVVIELLLSVSGVAKPSQVYFGGTVIGEQAMKSEEEVGSLIEYEFRVINLG
KPLKNLGTATLNIQWPKEISNGKWLLYLVKVESKGLEKIACQPQNEINFLKLKEAHNSRQ
KREIAERQTDDGRKFSLFAERKYQTLNCSVNVNCVNIKCPLRGLDSKASVVLRSRLWNST
FLEEYSKMNYLDILVRASIDVTAATENIKLPNAGTQVRVTVFPSKTVAQYSGVPWWIILV
AILAGILMLALLVFLLWKCGFFKRSRYDDSVPRYHAVRIRKEEREIQDEKYNDNLEKKQW
ITRWNENESYS
NT seq 3276 nt   +upstreamnt  +downstreamnt
atggcggccgcggggcggctgtggctgctctacctgtcggcggggctcctgccgcggctc
ggcgccgccttcaacttggacacccgcgaggacaatgtgatcgagaaaaccggggactcc
gggagcctcttcggcttctcgctggccatgcactggcagctgcagcccgaggacaagcgg
ctgttgctcgtgggggccccacgggcagtagcccttccgctgcagaaggccaacagaaca
ggaggcttgtatagctgcgacatcacctcccgggggccgtgcccacggattgaatttgat
aacgacgctgacccttcatcggaaagcaaggaagatcagtggatgggggtcactgtccag
agccaaggtccagggggcaaagttgtgacatgtgctcatcgatatgaaaaaaggcagcat
gttaatacaaaacaggaatcccgagacatttttggaaggtgttacgtcctaagtcagaat
ctcaggattgaagatgatatggatggaggagactggagtttttgtgatggccgattaaga
ggtcatgaaaaatttggctcttgccagcaaggtgtagcggctacttttactaaagacttt
cattacattgcgtttggagccccaggcacttacaactggaaagggatcgttcgcgtagag
caaaagaataacactttttttgacatgaacatctttgaagatgggccttatgaagttggt
ggagagactgaccatgatgaaagtctagttcctgttcctgctaacagttatttagggttt
tctttggactcagggaagggtattgtttccaaagatgagatcacttttgtatctggtgct
cctagagccaatcacagtggagctgtggttttgcttaaaagagacctaaaatctgcgcac
cttctccctgagcacatatttgacggggaagggctggcttcttcatttggctatgacgtg
gcagtggtggaccttaacaaagatgggtggcaagatatagttattggagccccacagtat
tttgatagaagtggagaagttggaggtgcagcgtatgtctacattaaccagcaaggcaga
tggaataatgtcaagccaattcgtcttaatggaaccaaagattctatgtttggcattgcg
gtcaaaaatatcggcgatattaatcaagatggctacccagatattgcagttggagcaccc
tacgatggtaaggggaaggtttttgtctatcacggatctgcgaacggaataaataccaaa
ccaacacagattctcgagggtaaatcacctttttttggatattcaattgccggaaacatg
gaccttgatagaaattcctaccccgatgttgctgttggttccctctcagattcagtaact
attttcagatcccggcctgtgattaatattcagcaaaccatcacagttacacctaacaga
attgatctccatcagaaaatgccctgtggggcacctagcgggatatgcctgaaggttaag
gcctgttttgaatatactgccaaacccactggttacaacccttcaataaccattgcgggc
acactggaggctgaaaaggaaagaagaaaatctgggctgtcatcaagagttcagtttcga
aaccaaggttctgagcccaagtatacgcaagagctcactctgagcaggcagaagcagaag
atgtgcatggaggaaaccttctggctccaggaaaatatcagagataaactgcgtcccatc
cctataacggcttcagtagagatccaagagccaagcactcggaggagagtgaattcgctt
ccagaagttcttccaattctgaattcaaacgaacccaagtctgttcatacagatgtgcac
ttcttaaaagagggatgtggagacgacaatgtatgtaacagcaaccttaagctagagtat
aaattttgtacccgagaaggaagtcaagacaaattttcttatttaccaattcaaaaaggt
gtaccagaactagttctaaaagatcagaaggacattgctttagaaataacagtgacaaac
agcccttccaacccaaagaatcccaccaaagatggtgatgacgctcatgaagctaaactc
atcgccacttttccggacactttgacttattctgcatatagagaactgaaggctttccct
gagaaacagttgagttgtgttgcaaaccagaacggctcacaagcagactgcgagcttggg
aatccttttaaaagaaattccagtgttactttttatttaattttaagtacaagtgagatc
acctttgacaccacagacctggatattaatctgaagttggaaacaacaagcaatcaagat
aatttggcttcaattacagctacagcaagagtggttattgaactgcttttatcggtctcc
ggagttgctaaaccttcccaggtgtattttggaggtacagtcattggtgagcaagctatg
aaatctgaagaggaagtgggaagtttaattgagtatgagttcagggtgattaacttgggc
aaacctcttaaaaacctcggcacagcaaccttgaatatccagtggccaaaagaaattagc
aatggcaaatggttgctttatttggtgaaagtagaatccaaaggattggaaaagatagct
tgtcagccacaaaacgaaataaacttcctgaaactaaaggaggctcacaactcaagacag
aaacgagaaattgctgaaagacagacagacgatggtagaaaattttctttatttgctgaa
agaaaataccagaccctcaactgcagcgtgaacgtgaactgtgtgaacatcaagtgtccg
ctccgagggctggatagcaaggcctccgtggttctgcgctcgaggctctggaacagcacg
tttctggaggagtactccaagatgaactacctggacattctcgtgcgggcttccattgat
gtaactgctgccaccgagaatattaagctgcccaatgcaggcactcaggttcgtgtgact
gtgtttccctcaaagactgtagctcaatattcaggagtaccttggtggatcatcctagtg
gctattcttgctgggattttgatgcttgctctattagtatttttactatggaagtgtgga
ttctttaaacgctctaggtacgacgatagtgttccccgctaccatgctgtaaggatccgg
aaagaggagcgagagatccaagatgaaaaatataacgataaccttgaaaaaaaacagtgg
atcacaaggtggaatgaaaatgaaagctactcctag

KEGG   Physeter catodon (sperm whale): 102994051
Entry
102994051         CDS       T06011                                 

Gene name
ITGA2B
Definition
(RefSeq) integrin alpha-IIb isoform X6
  KO
K06476  integrin alpha 2B
Organism
pcad  Physeter catodon (sperm whale)
Pathway
pcad04015  Rap1 signaling pathway
pcad04151  PI3K-Akt signaling pathway
pcad04510  Focal adhesion
pcad04512  ECM-receptor interaction
pcad04611  Platelet activation
pcad04640  Hematopoietic cell lineage
pcad04810  Regulation of actin cytoskeleton
pcad05165  Human papillomavirus infection
pcad05200  Pathways in cancer
pcad05222  Small cell lung cancer
pcad05410  Hypertrophic cardiomyopathy
pcad05412  Arrhythmogenic right ventricular cardiomyopathy
pcad05414  Dilated cardiomyopathy
pcad05418  Fluid shear stress and atherosclerosis
Brite
KEGG Orthology (KO) [BR:pcad00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04015 Rap1 signaling pathway
    102994051 (ITGA2B)
   04151 PI3K-Akt signaling pathway
    102994051 (ITGA2B)
  09133 Signaling molecules and interaction
   04512 ECM-receptor interaction
    102994051 (ITGA2B)
 09140 Cellular Processes
  09144 Cellular community - eukaryotes
   04510 Focal adhesion
    102994051 (ITGA2B)
  09142 Cell motility
   04810 Regulation of actin cytoskeleton
    102994051 (ITGA2B)
 09150 Organismal Systems
  09151 Immune system
   04640 Hematopoietic cell lineage
    102994051 (ITGA2B)
   04611 Platelet activation
    102994051 (ITGA2B)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    102994051 (ITGA2B)
  09162 Cancer: specific types
   05222 Small cell lung cancer
    102994051 (ITGA2B)
  09166 Cardiovascular disease
   05418 Fluid shear stress and atherosclerosis
    102994051 (ITGA2B)
   05410 Hypertrophic cardiomyopathy
    102994051 (ITGA2B)
   05412 Arrhythmogenic right ventricular cardiomyopathy
    102994051 (ITGA2B)
   05414 Dilated cardiomyopathy
    102994051 (ITGA2B)
  09172 Infectious disease: viral
   05165 Human papillomavirus infection
    102994051 (ITGA2B)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01009 Protein phosphatases and associated proteins [BR:pcad01009]
    102994051 (ITGA2B)
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:pcad04147]
    102994051 (ITGA2B)
   04515 Cell adhesion molecules [BR:pcad04515]
    102994051 (ITGA2B)
   04090 CD molecules [BR:pcad04090]
    102994051 (ITGA2B)
Protein phosphatases and associated proteins [BR:pcad01009]
 Protein serine/threonine phosphatases
  Phosphoprotein phosphatases (PPPs)
   Protein phosphatase-1
    PP1-interacting proteins (PIPs)
     102994051 (ITGA2B)
Exosome [BR:pcad04147]
 Exosomal proteins
  Exosomal proteins of haemopoietic cells  (B-cell, T-cell, DC-cell, reticulocyte, and mast cell)
   102994051 (ITGA2B)
Cell adhesion molecules [BR:pcad04515]
 Integrins
  Integrin alpha subunits
   102994051 (ITGA2B)
CD molecules [BR:pcad04090]
 Proteins
  102994051 (ITGA2B)
SSDB
Motif
Pfam: Integrin_alpha2 FG-GAP VCBS Integrin_alpha
Other DBs
NCBI-GeneID: 102994051
NCBI-ProteinID: XP_007127991
UniProt: A0A2Y9FR54
LinkDB
Position
Unknown
AA seq 1034 aa
MARALCPLHALWVLEWVQLLLGPGAAPPTWALNLDQVRLTFYTGPNGSYFGFSLDFYKDS
RGSVSIVVGAPRTLGRSQEETGGVFLCPWKAEGDQCTSLPFDLNDETRSVGTQTFQTFKA
RQGLGASVVSWSDIIVACAPWQHWNVLEKAEEAEKTPVGGCFVAQLQNGGRAEYSPCRAN
IMSRVYEKNYFSGDKRYCEAGFSSVVTQAGELVLGAPGGYYFLGLLARAPIADIISSYRP
ATLLWHVPTQQLTFDYSHPEYFDGYRGYSVAVGDFDGNPNTTEFVFGAPTWSWTLGAVEI
LDSYHQTLHRLHGEQMASYFGHSVAVTDVNRDGRHDLLVGAPLYMESRADLKLAEVGRVY
LFLQTRGPHALGAPSLRLTGTQLYGRFGSAIAPLGDLNRDGYNDVAVAAPYGGPSGRGQV
LVFLGQSEGLNSHPSQVLDSPFPTGSGFGFSLRGATDIDDNGYPDLLVGAYRANKIVVYR
AQPVVMATLQLLVQDSLNPAVKNCVLPQTETPVSCFNIQMCVGATGHNVPKKLRLNAELQ
LDRQKPRQGRRVLLLASQQAGTILDLDLSGRHGPTCHTTKAFLRDEADFRDKLSPIVLSF
NVSLQPERDGLAPALMLHGDTHIQEQTRIILDCGEDDLCVPQLQLTASVTGSPLLIGADN
VLELQMEAANEGEGAYEAELAVHLPPGAHYMRALSNIEGFERIICNQKRENETKVVLCEL
GNPMKRNAQIRITMLVSVGNLEEAGEHVSFRLQIRSKNSQNPNSEMVMLDVPVRAEAHVE
LRGSSFPASLVVAAEEGKRENSSDSWGPKVEHTYELHNNGPGAVNGLRLNLHLPGQSQPS
DLLYILDIQPRGGLQCSPQPSPNPLKLDWGLPTSSPSPAHHKRDRRQALLPEQEQPSRLQ
GPVFVSCDSAPCTVVQCELQEMARGQRVMVTVLAFLSLPSLRQRPLDQFVLQSHAWFNVS
SLPYAVPALSLPSGEALVQTQLLRVLEERDIPIWWVLVGVLGGLLLFTFLVLAMWKVGFF
KRNRPPLEEDDEEE
NT seq 3105 nt   +upstreamnt  +downstreamnt
atggccagagctttgtgtccacttcatgccctctgggttctggagtgggtgcagctgctc
ttgggacccggtgctgcacctccaacctgggccttgaacctggaccaagtgcgactcacc
ttctacacaggccccaatggcagctactttgggttttcattggacttctacaaggacagc
cgtgggagcgtgtccatcgtggtgggcgccccacggaccctgggccgcagccaggaggag
acaggcggcgttttcctgtgcccctggaaggccgagggcgaccagtgtacctcgctgccc
ttcgacctcaatgatgagacgcgaagcgtaggcacccaaactttccaaaccttcaaggcc
cgtcaaggactaggggcgtcggtcgttagctggagcgacatcattgtggcctgcgcccca
tggcagcactggaacgtcctggaaaaggccgaggaggctgagaagacgcccgtaggtggc
tgcttcgtggctcagctgcagaacggcggccgcgcggagtactcaccctgccgggccaac
atcatgagccgggtttacgagaaaaattacttcagcggagacaagcgctactgtgaagcc
ggcttcagctccgtggtcactcaggctggggagctggtgcttggggcccctggcggctac
tatttcctaggtctcctggcgcgggctccaattgccgatatcatctcgagttaccgcccg
gctaccctcttgtggcacgtgcccacccagcagctcaccttcgactacagccacccagag
tacttcgacggctaccgggggtactcggtggctgtaggcgacttcgacgggaatccaaac
actacagagtttgtcttcggtgcccctacctggagctggaccctgggagcggtggaaatt
ttggactcgtaccaccagacgctgcaccggctgcacggagagcagatggcttcgtatttc
gggcactcagtggccgtcactgacgtcaacagggacgggaggcatgacctcttggtgggc
gcgccactgtacatggagagccgtgctgacctcaagctggccgaggtggggcgcgtgtac
ttgttcctgcagactcgaggccctcacgcgctgggcgcccccagcctccggctgaccggc
acgcagctctatgggcgatttggctcagccatcgcgcctctgggcgacctcaaccgggat
ggctacaacgatgttgctgtggccgccccctatgggggtcccagcggtcgaggccaagtg
ttggtgttcctgggtcagagtgagggacttaactcacacccttcccaggtcctggacagc
cccttccccacaggctctggctttggcttctcccttcgaggtgccacagacatcgatgac
aatggatacccagacctgctggtgggagcttacagggccaacaagattgtagtgtacagg
gctcagccggtggtgatggccactctccagctgctggtgcaagattcgctgaatcctgct
gtgaagaactgtgtcctgccccagaccgagacaccagtgagctgctttaatatccagatg
tgtgtgggagccactggacacaacgttcccaagaagctgcgcctaaatgccgagctgcag
ctggaccggcagaagccccgccagggccggcgggtgctactgctggcctctcaacaggcg
ggcaccatcctggacctggatctgagcgggaggcacggccccacctgccacaccaccaag
gccttcctccgagatgaggccgacttccgggacaaactgagccccatcgtgctcagcttc
aatgtgtccctgcagcctgagagggatggactagcccctgctctcatgttgcatggagac
acccacatccaggaacagacccgcatcattctggactgtggggaagacgacctgtgtgtg
ccacagctccagctcactgccagcgtgacaggctccccgctcctcattggagccgataac
gtgctggagctgcagatggaagcggccaacgagggtgagggagcctacgaggccgagctg
gctgtgcacctgcctccaggcgcacactatatgcgggccctcagcaacatcgagggcttt
gagaggatcatctgtaaccagaagagggagaatgagaccaaggtggtgctgtgtgagctg
ggcaaccccatgaagaggaacgcccagataagaatcacgatgttggtgagtgtggggaac
ctggaagaggctggggagcacgtgtccttccggctgcagataaggagcaagaacagccag
aatcccaacagtgagatggtgatgctggatgtgccagttcgggcagaggcccatgtggag
ctgagagggagctcctttccagcctccctggtggtggcagcagaagaaggcaagagggag
aacagctcggacagctggggccccaaagtggagcacacctatgagctccacaacaatggc
cctggtgctgtaaatggcctccgcctcaacctccacctccccggccagtcgcagccctcc
gaccttctctacatcctggatatacagccccggggaggccttcagtgctccccacaaccg
tctcccaaccccctcaagctggactgggggctgcccacctccagcccttccccagcccat
cacaagcgggaccgcagacaggcactcctgccagagcaggagcagccctcgaggcttcaa
ggtccagtttttgtgagctgcgattcggcgccctgtactgtggtgcagtgtgagctgcag
gagatggcgcgcgggcagcgggtcatggtcacggtgctggccttcctgtcgctgcccagc
ctccgccagaggcccctggatcagtttgtgctgcagtcgcacgcttggttcaacgtctcc
tcccttccctacgccgtgcccgccctcagcctgcccagcggggaagctctggtgcagaca
cagctgcttcgggtcttggaagagagagacattccaatctggtgggtgctggtaggcgtg
ctgggtggcctgctgttgttcacgttcctggtcctggccatgtggaaggttggcttcttc
aagcggaatcggccacccttagaagaagatgatgaagaggagtga

KEGG   Physeter catodon (sperm whale): 102994576
Entry
102994576         CDS       T06011                                 

Gene name
ITGA11
Definition
(RefSeq) integrin alpha-11 isoform X1
  KO
K06587  integrin alpha 11
Organism
pcad  Physeter catodon (sperm whale)
Pathway
pcad04151  PI3K-Akt signaling pathway
pcad04510  Focal adhesion
pcad04512  ECM-receptor interaction
pcad04810  Regulation of actin cytoskeleton
pcad05165  Human papillomavirus infection
pcad05410  Hypertrophic cardiomyopathy
pcad05412  Arrhythmogenic right ventricular cardiomyopathy
pcad05414  Dilated cardiomyopathy
Brite
KEGG Orthology (KO) [BR:pcad00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04151 PI3K-Akt signaling pathway
    102994576 (ITGA11)
  09133 Signaling molecules and interaction
   04512 ECM-receptor interaction
    102994576 (ITGA11)
 09140 Cellular Processes
  09144 Cellular community - eukaryotes
   04510 Focal adhesion
    102994576 (ITGA11)
  09142 Cell motility
   04810 Regulation of actin cytoskeleton
    102994576 (ITGA11)
 09160 Human Diseases
  09166 Cardiovascular disease
   05410 Hypertrophic cardiomyopathy
    102994576 (ITGA11)
   05412 Arrhythmogenic right ventricular cardiomyopathy
    102994576 (ITGA11)
   05414 Dilated cardiomyopathy
    102994576 (ITGA11)
  09172 Infectious disease: viral
   05165 Human papillomavirus infection
    102994576 (ITGA11)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04515 Cell adhesion molecules [BR:pcad04515]
    102994576 (ITGA11)
Cell adhesion molecules [BR:pcad04515]
 Integrins
  Integrin alpha subunits
   102994576 (ITGA11)
SSDB
Motif
Pfam: Integrin_alpha2 VWA FG-GAP VWA_2 VCBS FG-GAP_2 Ku_N
Other DBs
NCBI-GeneID: 102994576
NCBI-ProteinID: XP_023984512
UniProt: A0A2Y9T4H5
LinkDB
Position
11
AA seq 1188 aa
MDLPRGLLVAWALSLWPGFTDTFNMDIKKPRVIPGSRAAFFGYTVQQHDISGKKWLVIGA
PLETNGHQKTGDVYKCPVTQGNCTKLNLGRVTLSNVSERKDNMRLGLSLATNPKDNSFLA
CSPLWSHECGSSYYTTGMCSRVNSNFRFSKTVAPALQRCRTYMDIIIVLDGSNSIYPWVE
VQHFLINILKKFYIGPGQIQVGVVQYGEDVVHEFHLNDYRSVKDVVEAASHIEQRGGTET
RTAFGIEFARSEAFQKGGRKGAKKVMIVITDGESHDSPDLEKVIQQSERDNVTRYAVAVL
GYYNRRGINPEAFLNEIKYIASDPDDKHFFNVTDEAALKDIVDALGDRIFSLEGTNKNET
SFGLEMSQTGFSSHIVEDGILLGAVGAYDWNGAVLKETSGGKVIPLRESYLKEFPEELKN
HGAYLGYTVTSVVSSRQGRVYVAGAPRFNHTGKVILFTMHNNRSLTIHQALQGEQIGSYY
GSEITSVDIDGDGVTDVLLVGAPMYFSEGGERGRVYIYNLRQNRFVYDGTLKDSHSYQNA
RFGSSIASVQDLNQDSYNDVVVGAPLEDNHRGVIYIFHGFQGSILKTPKQRIAASELAPG
LQYFGCSIHGQLDLDEDGLVDLAVGALGNAVILWSRPVVQINASLHFEPSKINIFHRDCK
RSGRDATCLAAFLCFTPVFLAPHYQTSTVGIRYNATMDERRYTPRAHLDEGGDRYTNRAA
LLSSSQEHCDRINFHVLDTADYVKPVTFSVEYSLEDPDYGPVLDDGWPTTLRVSVPFWNG
CNEDEHCVPDLLLDARSDLPTAMEYCQRVLRKPAQDCSAYTLSFDTTVFIIESTRRRVAV
EALLENKGENAYSTVLNISQSANLQFASLIQKDDSDGSIECVNEEKRLHKKVCNVSYPFF
RAKAKVAFRLDFEFSKSVFLHHMEIQLTAGSDSDEEESTKEDNTALLRLHLKYEADVLFT
RSSSLSHYEVKPNSSLERYHGIGPPFNCVFKIQNLGLFPIHGVMMKFTVPIATRGGNRLL
LLKGFLADQANTSCNIWGNSTEYRHAPMEEDLSRAPQLNHSNADVVSINCNVRLAPNQEI
SFHLLGNLWLRSLKALKYKSMRITVHAALQRQFHSPFIFREEDPSRQITFEISKQEDSQI
PIWIIVGSSLGGLLLLALLVLALWKLGFFKSAKRRREPGLDPTPKVLE
NT seq 3567 nt   +upstreamnt  +downstreamnt
atggacctgcccaggggcctcctggtggcctgggccctcagcctgtggccagggttcacg
gacaccttcaacatggacatcaagaagccccgagtcatccccggctccagagccgccttc
tttggctacacggtgcagcagcatgacatcagcggcaagaagtggttggtcattggcgct
ccactggaaaccaacggccaccagaagacaggagacgtgtacaagtgtccagtgacccaa
gggaactgcaccaagctcaacctgggaagggtcaccctatccaacgtgtccgagaggaaa
gacaacatgcgtctcggcctgagcctggccaccaaccccaaggacaacagcttcctggct
tgcagccccctctggtctcatgagtgtgggagttcctactacaccacagggatgtgttca
cgagtcaactccaacttcaggttctccaagaccgtggccccagctctccaaaggtgccgg
acctacatggacatcatcattgtcctggatggttcaaacagcatctacccctgggtggag
gttcagcacttcctcatcaacatcctgaagaagttttacatcggccctgggcagatccag
gttggagtcgttcagtacggagaagacgtggtacatgaatttcacctcaatgactacagg
tctgtaaaagatgtggtggaagctgccagccacattgaacagagaggaggaacagagacc
cggacggcatttggcattgaatttgctcgctcagaggctttccagaagggtggaaggaaa
ggggccaagaaggtgatgatcgtcatcacggatggggagtcccacgacagcccagacctg
gagaaggtgatccagcaaagcgagagggacaacgtgaccagatacgctgtggccgtcctg
ggctactacaaccgcagggggatcaatccagaagcttttctaaacgaaatcaaatacatc
gccagtgaccccgatgacaagcacttcttcaacgtcactgatgaggcggccctgaaggac
attgtcgacgccctgggggacaggatcttcagcttggaaggcaccaacaagaatgaaacc
tccttcgggctggagatgtcacagacgggcttttcctctcacatagtggaggacgggatt
ctgctgggagccgttggtgcctatgactggaatggagctgtgctaaaggaaaccagcggc
gggaaggtcattcctctccgagagtcctacctgaaggagttccccgaggagctcaagaac
cacggcgcgtacctggggtacacagtcacatcggtcgtgtcctccaggcaggggcgggtg
tatgtggccggagccccccggttcaaccacacaggcaaagtcatcctgttcactatgcac
aacaaccggagtctcaccatccaccaggccctgcagggcgagcagataggctcttactac
gggagcgagatcacctcagtggacatcgatggcgacggtgtgactgatgtcctgctggtg
ggcgcaccaatgtacttcagtgagggcggagagcggggcagggtgtacatctacaacctg
agacagaaccggtttgtttacgatggaacactgaaggattcccacagttaccagaatgcc
cgattcggctcctccatcgcctcggttcaggacctcaatcaagattcctacaacgacgtg
gtggtgggagcccctctggaggacaaccacagaggagtcatctatatcttccacggcttc
cagggcagcatcctaaagacaccgaagcagagaatcgctgcctcagagctggctccaggc
ctccagtattttggctgcagcatccatgggcaattggacctcgacgaggatgggcttgtg
gacctggctgtgggcgcccttggcaacgccgtgattttgtggtcccgccctgtggttcag
atcaatgccagcctccactttgagccatccaagatcaacatctttcacagggattgcaaa
cgcagtggcagagacgccacctgcctggccgccttcctctgcttcacacccgtcttcctg
gcacctcattaccaaacttcaacagtcggcatcaggtataacgccaccatggatgagagg
cggtacacgccgcgggcccacctggatgagggcggggaccggtacactaacagagctgcc
ctgctctcctccagccaggaacactgtgaccggatcaatttccatgtcctggacaccgct
gactacgtaaagccagtgaccttctcggtcgagtattccctggaggaccccgactatggc
cccgtgctggatgacggctggcccacgaccctcagagtctcggtacccttctggaatggc
tgcaatgaggatgagcactgtgtccctgacctcctgctggacgcccgcagtgacctgccc
acagccatggagtactgccagagggtgctgaggaagcctgcccaggactgctctgcgtac
acactgtcctttgacaccacggttttcatcatagagagcacacggcggcgggtggcggtg
gaggccctgctggagaacaagggcgagaacgcctacagcacagtcctaaatatttcacag
tcagcaaacctgcagtttgccagcttgatccagaaggacgactccgacggcagcatcgag
tgtgtgaatgaggagaagaggctccacaagaaagtctgcaacgtcagctaccccttcttc
cgggccaaggccaaggtggctttccgtctcgatttcgagttcagcaaatccgtcttcctg
caccacatggagatccagctcacagcgggcagtgacagtgacgaggaagagagcaccaag
gaagacaacacggccctcctgcgcttgcacctcaagtatgaggctgacgtgctcttcacc
aggagcagcagcctgagccactacgaggtcaagcccaacagctcgctggagagataccat
ggcattgggcctcccttcaactgcgttttcaagatccaaaacttgggcttgttccccatc
cacggggtgatgatgaagttcactgttcccatcgcaaccaggggtggcaaccggctgctg
ctgctgaagggcttcctcgctgaccaggcgaacacgtcctgtaacatctgggggaacagc
actgagtaccggcacgccccgatggaggaggacttgagtcgtgccccacagctgaatcac
agcaacgctgatgtagtttccatcaactgcaacgtgaggctggcccccaaccaggaaatc
agtttccatctgctggggaacctgtggttgaggtccctaaaagcactcaagtacaagtcg
atgagaatcacggtccacgcagccttgcagaggcagttccacagccctttcatcttccgc
gaggaggatcccagccgccagatcacgtttgagatctcaaagcaagaggactcacagatc
cccatctggatcatcgtgggcagctccctggggggcctcctgctgctggcgctgctggtc
ctggcactgtggaagctcggcttctttaaaagtgccaagcgcaggagggagcccggcctg
gaccccacccccaaagtgctggaatga

DBGET integrated database retrieval system