KEGG   Physeter catodon (sperm whale): 102976634
Entry
102976634         CDS       T06011                                 

Gene name
POLK
Definition
(RefSeq) DNA polymerase kappa isoform X1
  KO
K03511  DNA polymerase kappa [EC:2.7.7.7]
Organism
pcad  Physeter catodon (sperm whale)
Pathway
pcad03460  Fanconi anemia pathway
pcad05169  Epstein-Barr virus infection
pcad05200  Pathways in cancer
pcad05202  Transcriptional misregulation in cancer
pcad05210  Colorectal cancer
pcad05212  Pancreatic cancer
pcad05213  Endometrial cancer
pcad05214  Glioma
pcad05216  Thyroid cancer
pcad05217  Basal cell carcinoma
pcad05218  Melanoma
pcad05220  Chronic myeloid leukemia
pcad05222  Small cell lung cancer
pcad05223  Non-small cell lung cancer
pcad05224  Breast cancer
pcad05225  Hepatocellular carcinoma
pcad05226  Gastric cancer
Brite
KEGG Orthology (KO) [BR:pcad00001]
 09120 Genetic Information Processing
  09124 Replication and repair
   03460 Fanconi anemia pathway
    102976634 (POLK)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    102976634 (POLK)
   05202 Transcriptional misregulation in cancer
    102976634 (POLK)
  09162 Cancer: specific types
   05210 Colorectal cancer
    102976634 (POLK)
   05212 Pancreatic cancer
    102976634 (POLK)
   05225 Hepatocellular carcinoma
    102976634 (POLK)
   05226 Gastric cancer
    102976634 (POLK)
   05214 Glioma
    102976634 (POLK)
   05216 Thyroid cancer
    102976634 (POLK)
   05220 Chronic myeloid leukemia
    102976634 (POLK)
   05217 Basal cell carcinoma
    102976634 (POLK)
   05218 Melanoma
    102976634 (POLK)
   05213 Endometrial cancer
    102976634 (POLK)
   05224 Breast cancer
    102976634 (POLK)
   05222 Small cell lung cancer
    102976634 (POLK)
   05223 Non-small cell lung cancer
    102976634 (POLK)
  09172 Infectious disease: viral
   05169 Epstein-Barr virus infection
    102976634 (POLK)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03400 DNA repair and recombination proteins [BR:pcad03400]
    102976634 (POLK)
Enzymes [BR:pcad01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.7  Nucleotidyltransferases
    2.7.7.7  DNA-directed DNA polymerase
     102976634 (POLK)
DNA repair and recombination proteins [BR:pcad03400]
 Eukaryotic type
  TLS (translesion DNA synthesis) factors
   Y-family DNA polymerases
    102976634 (POLK)
SSDB
Motif
Pfam: IMS IMS_C IMS_HHH ATP-cone
Other DBs
NCBI-GeneID: 102976634
NCBI-ProteinID: XP_007114954
UniProt: A0A2Y9F4J3
LinkDB
Position
8
AA seq 878 aa
MDSTEEKNDSTKEKNDNYKDDLLLRVGLNDNKAGMEGLDKEKINKIIMEATKGSRFYGNE
LKKEKQVNQRIENMMQQKAQITSQQLRKAQLQVDRFAMELEHSRDLNNTIVHIDMDAFYA
AVEMRDNPELKDKPIAVGSVSMLSTSNYHARRFGVRAAMPGFIAKRLCPQLIIVPPNFDK
YRAVSREVKEILADYDPNFMAMSLDEAYVNITKHLEERQNWPEDKRKYFIKTGNSLENDK
PGKKVNKLCEQERSISPLLFEDSPPDLQSPGNPFQVNFEELNNLQILQNSIVFGTSAEEV
VKEIRFRIEQKTTLTASAGIAPNTMLAKVCSDKNKPNGQYQILPNRQAVMDFIKDLPIRK
VSGIGKVTEKMLKALGIITCTELYQQRALLSLLFSETSWHYFLHISLGLGSTHLARDGER
KSMSVERTFSEISKAEEQYNLCQELCSELAQDLQKEGLKGRTVTIKLKNVNFEVKTRAST
VSSVVSTAEEIFAIAKELLRTEIDADFPHPLRLRLMGVRLSSFPNEEEKKHQQRSIIGFL
QPGNQALSATRCILEKTDKDQFLKPLEMSHKKSFFDKKRSERNWSYQDTFKCETVDKQSL
QTSQSFQVLKKRMNENLETLENSDNCHVFTCPVCFREQGNISLEAFNKHVDACLDGPSIG
GNSKMSSRSHASSTEVNEKENVHDSVSVCEKQDYESHQKNTEIISVDSVELAETTGNPSN
TEGVDALSNKHSEEECSSLPSKSFNMEHCPQNCCAVSLENEDVASLRRKEPLQPYLYEVI
SDQVLVCPVCNLEQKTSDLTLFNVHVDVCLNKGIIQELRKDKFNPVNQPKESTTSTDNSG
KVQKIGTKANRPGLMTKYSASKKTKPNSPRHTLDIFFK
NT seq 2637 nt   +upstreamnt  +downstreamnt
atggatagcacagaggagaagaatgacagcacaaaggagaagaatgacaattacaaagat
gaccttctgctaagggtgggacttaatgataataaagctggaatggaagggttagataaa
gagaaaattaacaaaattataatggaagccacaaaggggtccagattttatggaaacgag
ctcaagaaagaaaagcaagtcaaccaacgaattgaaaatatgatgcaacaaaaagctcaa
attaccagccagcagctaaggaaagcacaattacaggttgacagatttgcaatggaattg
gaacacagccgggatctgaacaataccatagtacacattgacatggatgctttctacgca
gctgtagaaatgagggacaatccagaactgaaggataaacccattgctgtcggatcagtg
agtatgttgtctacttcgaattaccacgcaaggagatttggtgttcgtgcagccatgcca
ggattcattgcaaaaagactctgcccacaacttattatagtgcccccaaactttgacaaa
taccgagctgtgagtagagaggttaaagaaatacttgctgattatgatcccaattttatg
gccatgagtcttgatgaagcctacgtgaatataacaaagcatttagaggaaagacaaaat
tggcctgaagacaaaaggaagtatttcatcaaaacagggaactctctagaaaatgataaa
ccaggaaagaaagttaataaactgtgtgagcaggaacgatccatctctcctctacttttt
gaagatagtcctcctgatttgcagtccccaggaaatcctttccaagtgaactttgaagaa
ctgaataatcttcaaatactccaaaactcaattgtttttggaacatcagctgaggaagtg
gtaaaggaaattcgtttcagaatcgagcaaaaaactacactgacagccagtgcaggcatt
gcaccaaatacaatgttagcaaaagtatgcagtgataagaataaaccaaatggacaatac
caaattcttcctaatagacaagctgtgatggacttcatcaaggacttacccattagaaag
gtttctggaataggaaaagttacagagaaaatgttgaaggcccttggaattattacttgt
acagaactctaccaacagagggcattactttctctccttttctctgaaacatcttggcat
tatttccttcatatttccctgggtctaggttcaacacacctggcaagggatggagagagg
aaaagcatgagtgttgagaggacattcagtgagataagtaaagcagaagaacagtacaac
ttgtgccaagaactttgcagtgaacttgctcaagatctgcagaaagaaggacttaagggt
agaactgttaccattaagctaaagaatgtgaattttgaagtaaaaactcgtgcatctaca
gtttcatctgttgtttctactgcagaagaaatatttgctattgctaaagaattgctaaga
acagaaattgatgctgattttccacatcccttgagattaagacttatgggggtgcggcta
tctagttttcccaatgaagaggaaaagaaacaccaacaaaggagcattattggcttctta
cagcctggaaaccaagctctgtcagccaccaggtgtatcctagagaaaactgacaaagat
cagtttctaaaacctctagaaatgtctcataagaagagtttctttgataaaaagcgatct
gaaaggaattggagctaccaggacacatttaaatgtgaaactgtagataaacaaagttta
cagacatcacaatccttccaagttttaaagaagaggatgaatgagaatttagaaacattg
gagaattcagataactgtcatgtatttacctgtcctgtttgcttcagggagcaaggaaac
atcagtctggaagcctttaataaacatgtagatgcatgtcttgatggaccttccatcggt
ggaaactctaaaatgtcctcacgttcacatgcttcctctacagaagtgaatgagaaagaa
aatgtacatgattctgtttctgtctgtgagaagcaggattatgaaagtcatcagaagaat
acagagatcatatcagtagattctgtagagttggcagagactactggtaatccatctaat
acagaaggtgtagatgctctaagtaataagcacagcgaagaggaatgttctagtcttcca
agcaaatcgtttaatatggaacactgtcctcagaattgttgcgctgtttcactggaaaat
gaagatgttgcgtcattaagaaggaaagagcccctacaaccttatttatatgaagtgatc
agtgaccaagtcctcgtttgtcctgtttgtaatctagaacaaaagacttcagatcttacc
ctattcaatgtgcatgtagatgtttgcttaaataaaggcattatccaggaactgagaaag
gataagtttaatccagttaaccaacccaaagaaagcaccacaagtactgataactcaggc
aaagtacagaagattggaacaaaagcaaacaggccaggactgatgacaaagtactcggca
tcaaagaaaacaaaaccaaacagtcccagacacacccttgatatattttttaaatga

DBGET integrated database retrieval system