KEGG   Physeter catodon (sperm whale): 102976660
Entry
102976660         CDS       T06011                                 

Gene name
KIF5B
Definition
(RefSeq) kinesin-1 heavy chain isoform X1
  KO
K10396  kinesin family member 5
Organism
pcad  Physeter catodon (sperm whale)
Pathway
pcad04144  Endocytosis
pcad04728  Dopaminergic synapse
pcad05010  Alzheimer disease
pcad05012  Parkinson disease
pcad05014  Amyotrophic lateral sclerosis
pcad05016  Huntington disease
pcad05020  Prion disease
pcad05022  Pathways of neurodegeneration - multiple diseases
pcad05132  Salmonella infection
pcad05223  Non-small cell lung cancer
Brite
KEGG Orthology (KO) [BR:pcad00001]
 09140 Cellular Processes
  09141 Transport and catabolism
   04144 Endocytosis
    102976660 (KIF5B)
 09150 Organismal Systems
  09156 Nervous system
   04728 Dopaminergic synapse
    102976660 (KIF5B)
 09160 Human Diseases
  09162 Cancer: specific types
   05223 Non-small cell lung cancer
    102976660 (KIF5B)
  09164 Neurodegenerative disease
   05010 Alzheimer disease
    102976660 (KIF5B)
   05012 Parkinson disease
    102976660 (KIF5B)
   05014 Amyotrophic lateral sclerosis
    102976660 (KIF5B)
   05016 Huntington disease
    102976660 (KIF5B)
   05020 Prion disease
    102976660 (KIF5B)
   05022 Pathways of neurodegeneration - multiple diseases
    102976660 (KIF5B)
  09171 Infectious disease: bacterial
   05132 Salmonella infection
    102976660 (KIF5B)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04131 Membrane trafficking [BR:pcad04131]
    102976660 (KIF5B)
  09183 Protein families: signaling and cellular processes
   04812 Cytoskeleton proteins [BR:pcad04812]
    102976660 (KIF5B)
   04147 Exosome [BR:pcad04147]
    102976660 (KIF5B)
Membrane trafficking [BR:pcad04131]
 Others
  Actin-binding proteins
   Others
    102976660 (KIF5B)
Cytoskeleton proteins [BR:pcad04812]
 Eukaryotic cytoskeleton proteins
  Microtubules
   Tubulin-binding proteins
    Kinesins
     102976660 (KIF5B)
Exosome [BR:pcad04147]
 Exosomal proteins
  Exosomal proteins of haemopoietic cells  (B-cell, T-cell, DC-cell, reticulocyte, and mast cell)
   102976660 (KIF5B)
SSDB
Motif
Pfam: Kinesin Microtub_bd Crescentin
Other DBs
NCBI-GeneID: 102976660
NCBI-ProteinID: XP_023972211
UniProt: A0A2Y9S0R1
LinkDB
Position
11
AA seq 964 aa
MADPAECNIKVMCRFRPLNESEVNRGDKYIAKFQGEDTIMIASKPYAFDRVFQSNTSQEQ
VYNDCAKKIVKDVLEGYNGTIFAYGQTSSGKTHTMEGKLHDPEGMGIIPRIVQDIFNYIY
SMDENLEFHIKVSYFEIYLDKIRDLLDVSKTNLSVHEDKNRVPYVKGCTERFVCSPDEVM
DTIDEGKSNRHVAVTNMNEHSSRSHSIFLINVKQENTQTEQKLSGKLYLVDLAGSEKVSK
TGAEGAVLDEAKNINKSLSALGNVISALAEGSTYVPYRDSKMTRILQDSLGGNCRTTIVI
CCSPSSYNESETKSTLLFGQRAKTIKNTVCVNVELTAEQWKKKYEREKEKNKTLRNTIQW
LENELNRWRNGETVPIDEQFDKEKANLEAFAVDKDITITNDKPAATIGVTGNFTDSERRK
CEEEIAKLYKQLDDKDEEINQQSQLVEKLKTQMLDQEELLASTRRDQDNMQAELNRLQAE
NDASKEEVKEVLQALEELAVNYDQKSQEVEDKTKEYELLSDELNQKSATLASIDAELQKL
KEMTNHQKKRAAEMMASLLKDLAEIGIAVGNNDVKQPEGTGMIDEEFTVARLYISKMKSE
VKTMVKRCKQLESTQTESNKKMEENEKELAACQLRISQHEAKIRSLTEYLQNVEQKKRQL
EESVDSLSEELVQLRAQEKVHEMEKEHLNKVQTANEVKQAVEQQIQSHRETHQKQISSLR
DEVEAKEKLITDLQDQNQKMALEQGRLRAEHEKLKAAEQDKSRKLRDLTVMQDRREQARQ
DLKGLEETVAKELQTLHNLRKLFVQDLATRVKKSAEVDSDDTGGSAAQKQKISFLENNLE
QLTKVHKQLVRDNADLRCELPKLEKRLRATAERVKALESALKEAKENASRDRKRYQQEVD
RIKEAVRSKNMARRGHSAQIAKPIRPGQHPAASPAHPSAVRGGGASVQNGPPAAVRGGGG
VKSN
NT seq 2895 nt   +upstreamnt  +downstreamnt
atggcggacccggccgagtgcaacatcaaagtgatgtgtcgcttcagaccgctgaacgag
tccgaggtgaaccgcggcgataagtacatcgccaagtttcagggagaagacacgatcatg
atcgcgtccaagccttatgcatttgaccgggtgttccagtcaaacacatctcaagagcaa
gtgtataatgactgtgcaaagaagattgttaaagatgtgcttgaggggtacaatggaacc
atatttgcatatggacaaacctcctccgggaagacacacacaatggagggtaaacttcat
gatccagaaggcatgggaattattccaagaatagtgcaagatatttttaattatatttac
tccatggatgaaaatttggaatttcatattaaggtttcatattttgaaatttatttggat
aagataagggacctgttagatgtttcaaagaccaatctttcagttcatgaagataaaaac
cgagttccctatgtaaaggggtgtacagagcgtttcgtatgcagtccagatgaagttatg
gacaccatagatgaaggaaaatccaacagacacgtagcagttacaaatatgaatgaacat
agctctaggagtcacagtatatttcttattaatgtaaaacaagagaacacgcaaacggaa
caaaagctgagtggaaaactttatctggttgatttagctggtagtgaaaaggttagtaaa
actggagctgaaggtgctgtgctggatgaagctaagaacatcaacaagtccctttctgct
cttggaaatgtcatttctgctttggctgagggtagtacatatgttccatatcgagatagt
aaaatgacaagaatccttcaagattcattaggtgggaactgtagaaccactattgtaatt
tgctgctctccatcatcgtacaatgaatctgaaacaaaatctacactcctgtttggtcag
agggccaaaacaattaagaacacagtttgtgtcaatgtagagttaactgcagaacagtgg
aaaaagaagtatgaaagagaaaaagaaaaaaataagaccctgcggaacaccattcagtgg
cttgaaaatgaactcaaccgatggcgtaatggagagacagtgcctattgatgaacagttt
gacaaggagaaagccaacctggaagcttttgcagtggataaggatattactattaccaat
gataaaccagcagccacaattggagttactggaaactttactgattctgaaagaagaaag
tgtgaagaagaaattgctaagttgtacaaacaacttgatgacaaggatgaagaaattaat
caacagagccaattggtagagaaactgaagacacaaatgttggatcaggaagagcttctg
gcatctaccagaagggatcaagataatatgcaggctgagctgaatcgtcttcaggcagaa
aacgatgcctctaaagaagaagtaaaggaagttttacaagccttagaggaacttgctgtc
aactatgatcagaagtctcaggaagttgaagacaaaactaaggaatatgagttacttagt
gatgagctgaatcagaaatcggcaactttagcaagtatagatgctgagcttcagaaactt
aaggaaatgaccaatcaccagaagaagcgagcagcggagatgatggcatctttactaaaa
gacctggcagaaatagggattgctgtaggaaacaacgacgtaaagcagcctgagggaact
ggcatgatagatgaagagttcactgttgcaaggctctacattagcaaaatgaagtcagaa
gtgaaaaccatggtgaagcgctgcaaacagctagaaagcacacaaactgagagcaacaaa
aaaatggaagaaaatgaaaaggagttagcagcatgccagcttcgtatctctcaacatgaa
gccaaaatcagatcattgactgaataccttcaaaatgtggagcaaaagaaaagacagctg
gaggagtctgtggattccctcagtgaagagctagtccagcttcgagcacaagagaaagtg
catgaaatggaaaaggagcacttgaataaagttcagactgcaaatgaagttaagcaagct
gttgaacagcagatccaaagccacagagaaacgcatcaaaaacaaattagtagtttgaga
gatgaagtcgaggcaaaagaaaaacttatcactgatcttcaagaccagaaccagaagatg
gcattagagcaaggacgcctgagagcggagcacgagaagctgaaggctgcagagcaggac
aagagcaggaagctgcgtgaccttacggttatgcaagatagacgagaacaagcgagacaa
gacctgaagggtttggaagagacggtggcgaaggaacttcagactttacacaacctgcgg
aagctctttgttcaggacctggccaccagggttaaaaagagcgccgaggttgattcggac
gacaccggaggcagtgccgctcagaagcaaaaaatctcctttctcgagaataatcttgaa
caactcaccaaagtccacaaacagctggtacgtgataacgcagatcttcgctgtgagctt
cctaagctggaaaagcgactcagagctacagctgagagagtgaaagctttggagtcggcg
ctgaaagaggccaaagaaaatgcatctcgcgatcgcaaacgctatcagcaggaagtagat
cgtataaaggaagcagtcaggtcaaagaatatggccagaagagggcattctgcacaaatt
gctaaacctattcgtcctgggcagcatccagcagcttctccggctcatcccagtgcagtt
cgtgggggaggtgcatctgtgcagaatggcccgccggcggccgtgcgaggtggaggaggt
gttaaaagtaattga

KEGG   Physeter catodon (sperm whale): 102981918
Entry
102981918         CDS       T06011                                 

Gene name
KIF5A
Definition
(RefSeq) kinesin heavy chain
  KO
K10396  kinesin family member 5
Organism
pcad  Physeter catodon (sperm whale)
Pathway
pcad04144  Endocytosis
pcad04728  Dopaminergic synapse
pcad05010  Alzheimer disease
pcad05012  Parkinson disease
pcad05014  Amyotrophic lateral sclerosis
pcad05016  Huntington disease
pcad05020  Prion disease
pcad05022  Pathways of neurodegeneration - multiple diseases
pcad05132  Salmonella infection
pcad05223  Non-small cell lung cancer
Brite
KEGG Orthology (KO) [BR:pcad00001]
 09140 Cellular Processes
  09141 Transport and catabolism
   04144 Endocytosis
    102981918 (KIF5A)
 09150 Organismal Systems
  09156 Nervous system
   04728 Dopaminergic synapse
    102981918 (KIF5A)
 09160 Human Diseases
  09162 Cancer: specific types
   05223 Non-small cell lung cancer
    102981918 (KIF5A)
  09164 Neurodegenerative disease
   05010 Alzheimer disease
    102981918 (KIF5A)
   05012 Parkinson disease
    102981918 (KIF5A)
   05014 Amyotrophic lateral sclerosis
    102981918 (KIF5A)
   05016 Huntington disease
    102981918 (KIF5A)
   05020 Prion disease
    102981918 (KIF5A)
   05022 Pathways of neurodegeneration - multiple diseases
    102981918 (KIF5A)
  09171 Infectious disease: bacterial
   05132 Salmonella infection
    102981918 (KIF5A)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04131 Membrane trafficking [BR:pcad04131]
    102981918 (KIF5A)
  09183 Protein families: signaling and cellular processes
   04812 Cytoskeleton proteins [BR:pcad04812]
    102981918 (KIF5A)
   04147 Exosome [BR:pcad04147]
    102981918 (KIF5A)
Membrane trafficking [BR:pcad04131]
 Others
  Actin-binding proteins
   Others
    102981918 (KIF5A)
Cytoskeleton proteins [BR:pcad04812]
 Eukaryotic cytoskeleton proteins
  Microtubules
   Tubulin-binding proteins
    Kinesins
     102981918 (KIF5A)
Exosome [BR:pcad04147]
 Exosomal proteins
  Exosomal proteins of haemopoietic cells  (B-cell, T-cell, DC-cell, reticulocyte, and mast cell)
   102981918 (KIF5A)
SSDB
Motif
Pfam: Kinesin Microtub_bd ATG16 Spc7
Other DBs
NCBI-GeneID: 102981918
NCBI-ProteinID: XP_028347004
UniProt: A0A455BE25
LinkDB
Position
6
AA seq 965 aa
MQIVKDVLAGYNGTIFAYGQTSSGKTHTMEGKLHDPQLMGIIPRIAQDIFNHIYSMDENL
EFHIKVSYFEIYLDKIRDLLDVTKTNLSVHEDKNRVPFVKGCTERFVSSPEEILDVIDEG
KSNRHVAVTNMNEHSSRSHSIFLINIKQENMETEQKLSGKLYLVDLAGSEKVSKTGAEGA
VLDEAKNINKSLSALGNVISALAEGTKSYVPYRDSKMTRILQDSLGGNCRTTMFICCSPS
NYNDAETKSTLMFGQRAKTIKNTASVNLELTAEQWKKKYEKEKEKTKAQKETIAKLETEL
SRWRSGEDVPETERLAGEDATLGAELCEETPVNDNSSIVVRIAPEERQKYEEEIRRLYKQ
LDDKDDEINQQSQLIEKLKQQMLDQEELLVSTRGDNEKVQQELSHLQSENDAAKEEVKEV
LQALEELAMNYDQKSQEVEEKSQQNQLLVDELSQKVATMLSLESELQRLQEVSGHQRKRI
AEVLNGLMKDLSEFSVIVGNGEIKLPVEISGAIEEEFTVARLYISKIKSEVKSVVKRCRQ
LENLQVECHRKMEVTGRELSSCQLLISQHEAKIRSLTEYMQSVELKKRHLEESYDSLSDE
LAKLQAQETVHEVALKDKEPDTQDSEDVKKALELQMDSHREAHHRQLARLRDEINEKQKT
IDELKDLNQKLQLELEKLQADYEKLKNEEHEKSTKLQELTFLYERHEQSKQDLKGLEETV
ARELQTLHNLRKLFVQDVTTRVKKSAEMEPEDSGGIHSQKQKISFLENNLEQLTKVHKQL
VRDNADLRCELPKLEKRLRATAERVKALEGALKEAKEGAMKDKRRYQQEVDRIKEAVRYK
SSGKRGHSAQIAKPVRPGHYPASSPTNPYGTRSPECISYTNSLFQNYQNLYLQAAPSSTS
DMYFANSCTSSGATSSGGPLASYQKANMDNGNATDINDNRSDLPCGYEAEDQAKLFPLHQ
ETAAS
NT seq 2898 nt   +upstreamnt  +downstreamnt
atgcagattgtcaaagatgtccttgccggctacaatggcaccatttttgcttatggacag
acatcctcagggaagacacatactatggagggaaagctgcatgacccccagctgatggga
atcattcctcgaattgcccaagacatcttcaaccacatctactccatggatgagaacctt
gagttccacatcaaggtttcctactttgagatttacctggacaaaatccgtgaccttctg
gatgtgaccaagacaaatctgtctgtgcacgaggacaagaaccgagtgccatttgtcaag
ggttgtaccgagcgctttgtgtccagcccagaagaaattttagatgtgattgatgaagga
aaatcaaaccgtcacgtggctgtcaccaacatgaatgaacacagctctcgaagccatagc
atcttcctcatcaatatcaagcaggagaatatggagaccgagcagaagctcagtgggaag
ctgtacctagtggacctggcagggagcgagaaggtcagcaagactggagcagagggagcc
gtgctggacgaggccaagaatatcaacaagtccctgtcagccctggggaacgtgatctct
gcgctggctgagggcacaaaaagctacgttccgtatcgtgacagcaaaatgacacggatt
ctccaggactccttgggaggaaactgccggacaaccatgttcatctgctgctcaccgtcc
aactacaacgatgcggagaccaagtccaccctgatgtttggacagcgggcgaagaccatt
aagaacactgcctccgtgaatctggagttgactgccgagcagtggaagaagaaatatgag
aaggagaaggagaagacaaaggctcagaaggagacgattgcaaagctggagacagagctg
agccggtggcgcagtggagaggacgtgccagagacagagcgcctggccggggaggatgcc
accctgggggctgagctctgcgaggagacgcccgtgaacgacaactcatccatcgtggtg
cgcatcgcgcctgaggaacgccagaagtacgaggaggagatccgccgcctctacaagcag
cttgatgacaaggatgatgagatcaaccaacagagccaactcatagagaagctcaagcag
cagatgctggaccaggaagagctgctggtgtccactcgaggagacaatgagaaggtccag
caggagctgagccacctgcagtcggagaacgacgccgcgaaggaggaggtgaaggaagtg
ctgcaggcactggaggagctggccatgaactacgaccagaagtcccaggaggtggaggag
aagagccagcagaaccagcttctggtggacgagctgtctcagaaggtggccaccatgctg
tccctggagtctgagttgcagcggctacaggaggtcagtggacaccagcgaaaacgaatt
gctgaggtactgaacgggctgatgaaggacctgagtgagttcagtgtcatcgtgggcaac
ggggagattaagctgccggtggagatcagcggggccatcgaggaggagttcactgtggcc
cgactctacatcagcaaaatcaaatcggaagtcaagtctgtggttaaaaggtgccggcag
ctggagaacctccaggtcgaatgtcaccgcaagatggaagtgactgggcgggagctctca
tcctgccagcttctcatctcccagcatgaggccaagatccgctccctgacggaatacatg
cagagcgtggagctcaagaagcggcacctggaagagtcctatgactccctgagtgatgag
ctggccaagctccaagcccaggaaactgtgcatgaagtggccctgaaggataaggagcca
gacacacaggactcagaagacgtgaagaaggccctggagctgcagatggacagccaccgg
gaggcccatcaccggcagctggcccggctccgggacgagatcaatgagaagcagaagacc
attgatgagctcaaagacctgaatcagaagctccagttagagctggagaagcttcaggct
gactatgagaagctgaagaatgaagaacatgagaaaagcaccaaactccaggagctgaca
tttctgtatgagcgacacgagcagtccaagcaggacctcaagggtctggaggagacagtt
gcccgggaactccagaccctccacaaccttcgcaagctgttcgttcaagacgtcacgact
cgagtcaagaaaagtgcagaaatggagcccgaggacagtggggggattcactcccaaaag
cagaagatttcctttcttgagaacaacctggaacagcttacaaaggttcacaaacagctg
gtacgtgacaatgcagatctgcgttgtgagcttcctaagttggaaaaacgacttagggct
acggctgagagagttaaggccctggagggtgcactgaaggaggccaaggagggcgccatg
aaggacaagcgccggtaccagcaggaggtggaccgcatcaaggaggccgttcggtacaaa
agctccggcaaacggggccattctgcccagattgccaaacccgtccggcctggccactac
ccagcatcttcacccaccaacccctatggcacccggagccctgagtgcatcagttacact
aacagcctcttccagaactaccagaatttgtacctgcaggctgcacctagctccacctca
gatatgtactttgcaaactcctgtaccagcagtggggctacatcttctggaggccccttg
gcttcctaccagaaggccaacatggacaacggaaatgccacagatatcaatgacaatagg
agtgacctgccgtgcggctacgaggctgaagaccaggccaagctgttccctctccaccag
gagacggcagccagctaa

KEGG   Physeter catodon (sperm whale): 102984604
Entry
102984604         CDS       T06011                                 

Gene name
RET
Definition
(RefSeq) proto-oncogene tyrosine-protein kinase receptor Ret
  KO
K05126  proto-oncogene tyrosine-protein kinase Ret [EC:2.7.10.1]
Organism
pcad  Physeter catodon (sperm whale)
Pathway
pcad04020  Calcium signaling pathway
pcad05200  Pathways in cancer
pcad05216  Thyroid cancer
pcad05223  Non-small cell lung cancer
pcad05230  Central carbon metabolism in cancer
Brite
KEGG Orthology (KO) [BR:pcad00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04020 Calcium signaling pathway
    102984604 (RET)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    102984604 (RET)
   05230 Central carbon metabolism in cancer
    102984604 (RET)
  09162 Cancer: specific types
   05216 Thyroid cancer
    102984604 (RET)
   05223 Non-small cell lung cancer
    102984604 (RET)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01001 Protein kinases [BR:pcad01001]
    102984604 (RET)
Enzymes [BR:pcad01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.10  Protein-tyrosine kinases
    2.7.10.1  receptor protein-tyrosine kinase
     102984604 (RET)
Protein kinases [BR:pcad01001]
 Receptor tyrosine kinases (RTK)
  RET family
   102984604 (RET)
SSDB
Motif
Pfam: PK_Tyr_Ser-Thr RET_CLD3 RET_CLD4 Pkinase RET_CLD1 Cadherin Pkinase_fungal RIO1
Other DBs
NCBI-GeneID: 102984604
NCBI-ProteinID: XP_028337722
UniProt: A0A455AMB7
LinkDB
Position
20
AA seq 1026 aa
MPLLYVHALQDVPEEVPSFRLGQHLYGAYRTRLHENDWVRIQEDTGLLYLNRSLDHSSWE
KLSIRNGGFPLLTVYLQVFLSPASLREGECQWPGCARVSFSIINASFPACSALKPRDLCF
PETGLSFRIRENRPPGTFHQFRLLPVQFLCPNVSAVYRLLGGESLPFGCAVDSLEVSTRW
ALDREQREKYELVAKCTVRVGAREEEVMVPFPVTVYDEDDSAPSFLGGVDTASAVVEFKR
KEGTVVATLRVFDADVVPASGELLRRYTSTLLSGDAWALQTFRVEHSPNETLAQTNGSFV
RATVHDYRLVLNRSLPISESRAVQLAVLVNDSDFQGPGEGVLLLHFNVSVVPVSLRLPST
YSFASSRRARRFAQIGKVCVENCQEFSGIHVQYKLQLSSANCSALGMVTSAEDATGTLFV
NDTEALQRPECAQLQYTVVAVERPTRQQAQAPLLVTLEGTYVAEEPGCPLSCAVSKRRPE
CEECGGLGSLTGRCEWRQGDGKGITRNFSTCSPSIKTCPDGHCDAVESRDANICPQDCLR
GGSVIGGHEPGERRGIKAGFGICNCFPEEKKCFCEPEDSPDPLCDELCRTVIAAAVLFSF
IVSVLLSTFCIHRYHKNAHKPPIASAEMTFRRPAQAFPVSYSSSGARRPSLDSVENQVSV
DAFKIPEDPKWEFPRKNLVLGKTLGEGEFGKVVKATAFRLKGKAGYTTVAVKMLKENASA
SELRDLLSEFNLLTQVSHPQVIKLYGACSQDGPLLLIVEYAKYGSLRGFLRESRKAGPGY
VGSRDSRNSSYLDNPEERALTMGDLISFAWQISRGMQYLAEMKLVHRDLAARNVLVAEGR
RMKISDFGLSRDVYEEDSYVKRSKGRIPVKWMAIESLFDHIYTTQSDVWSFGVLLWEIVT
LGGNPYPGIPPERLFNLLKTGYRMERPDNCSEEMYSLMLQCWKEEPDKRPVFADISKDLD
KMMVKSRDYLDLAASTPSDSLLYDDGLSEEEMPLVDCNNAPLPRTLPSTWIENKLYGRIS
HAFTRF
NT seq 3081 nt   +upstreamnt  +downstreamnt
atgcccctgctctacgtccacgccctgcaggacgtccccgaggaggtgcccagcttccgc
ctgggccagcacctctacggcgcctaccgcacacggctgcacgagaacgactgggtccgt
atccaggaggacacggggcttctctaccttaaccggagcctggaccacagctcctgggag
aagctcagcatccgcaacggtggcttcccgctgctcacagtctacctccaggtcttcctg
tcgcccgcgtcccttcgtgagggcgagtgccagtggccgggctgtgcccgagtgtccttc
tccatcatcaacgcctccttcccggcttgcagtgccctcaaaccccgggacctctgcttc
cccgagacgggcctgtccttccgcattcgggagaacaggcctcccggcaccttccaccaa
ttccgcctgctgcctgtgcagttcctctgccccaacgtcagcgcggtctacaggcttctg
ggaggtgagagtctgcccttcggctgcgctgtggacagcctggaggtgagcacgcgctgg
gccctggaccgcgaacagcgggagaagtatgagctggtggctaagtgcacggtgcgcgtc
ggcgcgcgtgaggaggaggtgatggtgccctttcccgtgaccgtgtacgacgaagacgac
tctgcgcccagcttcctcgggggcgtcgacaccgccagcgccgtggtggagttcaagcgg
aaggagggcactgttgtggccacactacgtgtcttcgatgcagatgtggtgccagcatcc
ggggagctcctgagacggtacacaagcacgctgctctccggggatgcctgggccctccag
accttccgagtagagcactcgcccaacgagaccttggcccagaccaacggcagctttgtg
cgggcaaccgtgcatgactacaggctggttctcaaccggagcctccccatctcggagagc
cgggcggtgcagctggccgtgctggtcaacgactcggacttccagggcccaggggagggc
gtcctcctcctccacttcaacgtgtctgtggtgcccgtcagcctgcgcctgcccagcacc
tactcctttgcctcaagcaggcgggcccgccgcttcgcccagattgggaaagtctgtgtg
gaaaactgccaggagttcagtggcatccacgtgcagtacaagcttcagctctccagcgcc
aactgcagcgccctggggatggtcacctcggccgaggacgccacggggaccctgttcgtg
aacgacacggaggccctgcagcggcccgagtgtgcccagctccagtacacggtagtggcc
gtcgaacggccaacccgccagcaagcccaggccccgctgctcgtcacactggaggggaca
tatgtggcagaggagccaggctgccccctgtcctgcgcggtcagcaagaggcggcctgag
tgtgaggaatgcggtggcctgggctctctgacgggcaggtgcgagtggagacagggagac
ggcaaagggatcaccaggaacttctccacctgctcccccagcatcaagacctgccccgat
ggccactgtgacgccgtggaaagcagagacgccaacatctgcccccaggactgcctccgg
ggcggcagcgtcattggtgggcacgaacctggggagcgccgggggattaaagccggcttc
ggtatctgcaactgcttcccggaggagaagaagtgcttctgcgagccggaagacagcccc
gacccgctgtgtgacgagctttgccgcacggtgatcgcggcagccgtgctcttctccttc
atcgtgtccgtgctgctgtccaccttctgcatccaccgctaccacaagaacgcccacaag
ccgcccatcgcctcagctgagatgaccttccgccggcctgcccaggcctttccggtcagc
tactcctcatccggtgcccgccggccctctctggactccgtggagaaccaggtctctgtg
gatgccttcaagatcccggaggatccaaagtgggaattccctcggaagaacttggttctt
ggaaaaactctgggagaaggagaatttggaaaagtggtcaaagcaacggccttccggctg
aaaggcaaagcagggtacacgactgtggctgtaaagatgctgaaagagaacgcctcggcg
agcgagctgcgggacctgctgtcagagtttaacctcctgacgcaggtcagccacccgcaa
gtcatcaagctatacggggcctgcagccaggacgggccacttctcctcatcgtggagtat
gccaagtacggctccctgcggggcttcctccgagagagccgcaaggcggggcctggctac
gtgggcagcagagacagccgcaactccagctacctggacaacccggaggagcgggccctg
accatgggcgacctcatctccttcgcctggcagatctcgcgggggatgcagtacctggcc
gagatgaagctcgtccatcgggacttggcagccagaaacgtcctagtagccgaggggcgc
aggatgaagatctcggattttggtctgtcccgagatgtttatgaagaggattcctacgtg
aagaggagcaagggtcggatcccagtcaagtggatggccattgagtccctcttcgatcac
atctacaccacccagagtgacgtgtggtccttcggtgtcctgctgtgggagattgtgacg
ctggggggcaacccctaccctgggattcctccagagcggctcttcaaccttctgaagaca
ggctaccggatggagaggccagacaactgcagcgaggagatgtacagtctgatgctgcag
tgctggaaggaggagccagacaagaggccagtgtttgccgacatcagcaaagacctggat
aagatgatggttaagagcagagactacttggacctggccgcatccaccccatctgattcc
ctgctgtacgacgacggcctgtcggaggaggagatgcccctggtggactgtaataacgct
cccctccctcgaaccctcccctccacgtggattgaaaacaaactctatggtagaatttca
catgcatttactagattctag

KEGG   Physeter catodon (sperm whale): 102993084
Entry
102993084         CDS       T06011                                 

Gene name
KIF5C
Definition
(RefSeq) kinesin heavy chain
  KO
K10396  kinesin family member 5
Organism
pcad  Physeter catodon (sperm whale)
Pathway
pcad04144  Endocytosis
pcad04728  Dopaminergic synapse
pcad05010  Alzheimer disease
pcad05012  Parkinson disease
pcad05014  Amyotrophic lateral sclerosis
pcad05016  Huntington disease
pcad05020  Prion disease
pcad05022  Pathways of neurodegeneration - multiple diseases
pcad05132  Salmonella infection
pcad05223  Non-small cell lung cancer
Brite
KEGG Orthology (KO) [BR:pcad00001]
 09140 Cellular Processes
  09141 Transport and catabolism
   04144 Endocytosis
    102993084 (KIF5C)
 09150 Organismal Systems
  09156 Nervous system
   04728 Dopaminergic synapse
    102993084 (KIF5C)
 09160 Human Diseases
  09162 Cancer: specific types
   05223 Non-small cell lung cancer
    102993084 (KIF5C)
  09164 Neurodegenerative disease
   05010 Alzheimer disease
    102993084 (KIF5C)
   05012 Parkinson disease
    102993084 (KIF5C)
   05014 Amyotrophic lateral sclerosis
    102993084 (KIF5C)
   05016 Huntington disease
    102993084 (KIF5C)
   05020 Prion disease
    102993084 (KIF5C)
   05022 Pathways of neurodegeneration - multiple diseases
    102993084 (KIF5C)
  09171 Infectious disease: bacterial
   05132 Salmonella infection
    102993084 (KIF5C)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04131 Membrane trafficking [BR:pcad04131]
    102993084 (KIF5C)
  09183 Protein families: signaling and cellular processes
   04812 Cytoskeleton proteins [BR:pcad04812]
    102993084 (KIF5C)
   04147 Exosome [BR:pcad04147]
    102993084 (KIF5C)
Membrane trafficking [BR:pcad04131]
 Others
  Actin-binding proteins
   Others
    102993084 (KIF5C)
Cytoskeleton proteins [BR:pcad04812]
 Eukaryotic cytoskeleton proteins
  Microtubules
   Tubulin-binding proteins
    Kinesins
     102993084 (KIF5C)
Exosome [BR:pcad04147]
 Exosomal proteins
  Exosomal proteins of haemopoietic cells  (B-cell, T-cell, DC-cell, reticulocyte, and mast cell)
   102993084 (KIF5C)
SSDB
Motif
Pfam: Kinesin Microtub_bd
Other DBs
NCBI-GeneID: 102993084
NCBI-ProteinID: XP_023978062
UniProt: A0A2Y9SKY2
LinkDB
Position
2
AA seq 957 aa
MADPAECSIKVMCRFRPLNEAEILRGDKFIPKFKGDETVVIGQGKPYVFDRVLPPTTTQE
QVYNACAKQIVKDVLEGYNGTIFAYGQTSSGKTHTMEGKLHDPQLMGIIPRIAHDIFDHI
YSMDENLEFHIKVSYFEIYLDKIRDLLDVSKTNLAVHEDKNRVPYVKGCTERFVSSPEEV
MDVIDEGKANRHVAVTNMNEHSSRSHSIFLINIKQENVETEKKLSGKLYLVDLAGSEKVS
KTGAEGAVLDEAKNINKSLSALGNVISALAEGTKTHVPYRDSKMTRILQDSLGGNCRTTI
VICCSPSVFNEAETKSTLMFGQRAKTIKNTVSVNLELTAEEWKKKYEKEKEKNKTLKNVL
QHLEMELNRWRNGEAVPEDEQISAKDQKPLEPCDNTPIIDNIVPVVAGISAEEKEKYDEE
ISSLYRQLDDKDDEINQQSQLAEKLKQQMLDQDELLASTRRDYEKIQEELTRLQIENEAA
KDEVKEVLQALEELAVNYDQKSQEVEDKTRANEQLTDELAQKTTTLTTTQRELSQLQELS
NHQKKRATEILNLLLKDLGEIGGIIGTNDVKTLADVNGVIEEEFTMARLYISKMKSEVKS
LVNRSKQLESAQMDSNRKMNASERELAACQLLISQHEAKIKSLTDYMQNMEQKRRQLEES
QDSLSEELAKLRAQEKMHEVSFQDKEKEHLTRLQDAEEMKKALEQQMESHREAHQKQLSR
LRDEIEEKQKIIDEIRDLNQKLQLEQEKLSSDYNKLKIEDQEREMKLEKLLLLNDKREQA
REDLKGLEETVSRELQTLHNLRKLFVQDLTARVKKSVELDNDEGGGSAAQKQKISFLENN
LEQLTKVHKQLVRDNADLRCELPKLEKRLRATAERVKALESALKEAKENAMRDRKRYQQE
VDRIKEAVRAKNMARRAHSAQIAKPIRPGHYPASSPTAVHAIRGGGGSSSNTTHYQK
NT seq 2874 nt   +upstreamnt  +downstreamnt
atggcggatccagccgaatgcagcatcaaagtgatgtgccggttccggccactcaacgaa
gctgagatcctccgcggggacaaattcatccccaaatttaaaggcgatgagaccgtggtg
atcgggcaaggaaagccatatgtcttcgacagagtgctgcctcccaccacaacccaagag
caggtttacaacgcgtgtgcaaagcaaattgtcaaagacgtccttgagggttataatggg
acaatttttgcgtatggacagacatcatcaggaaaaacgcacaccatggaggggaagctc
catgaccctcaactcatgggcatcatcccaaggatcgcacacgacatctttgaccatatc
tattccatggacgaaaacctggagttccacatcaaggtttcctattttgaaatctacttg
gacaaaatcagggacttactcgatgtatccaagacaaacttggctgttcacgaagataaa
aacagagtcccgtacgtaaaggggtgcaccgagcggtttgtgtcaagccccgaggaggtc
atggacgtgatagatgaaggcaaagcaaaccgccacgtggctgtaacgaacatgaatgaa
cacagctctagaagtcacagtatcttcctgattaatattaaacaagagaatgtagagact
gaaaaaaaactcagtgggaagctttatctagttgatttggctgggagtgaaaaggtcagc
aaaactggtgccgagggagctgttctcgacgaagctaaaaatatcaataagtctttgtct
gctcttggaaacgtgatctctgccttggcagaagggacaaaaacacacgtgccataccgg
gacagcaagatgactcggattcttcaggactctctgggtgggaactgtagaaccaccatc
gttatttgctgttctccctcggtgttcaatgaagctgagaccaagtcaacgctaatgttt
ggacaaagggctaagaccatcaagaatacagtctctgtgaacctggagctgacagcggaa
gaatggaagaagaaatatgaaaaagagaaagagaaaaacaagactttgaagaatgttctc
cagcatctggagatggagctaaacaggtggagaaatggagaagctgtgcctgaggatgaa
cagatcagtgctaaggaccagaagcccctggagccctgtgataacacccccatcatagac
aacattgttcctgtggttgctggcatctctgcagaggagaaggagaagtatgatgaggag
atctccagtctctaccgacaactggatgataaggatgatgaaattaaccagcagagccag
ctggctgaaaagctaaagcaacagatgttggatcaggatgagcttttagcttctacaaga
agagactatgagaagattcaggaggagctgacacgtctccagattgaaaatgaggcagcc
aaagatgaggtgaaagaagttctccaggccctggaggagctggctgtcaattacgaccag
aagtcacaggaagtggaggacaagaccagggccaatgagcagctgacagatgagctggcc
cagaaaacgactacattgacaaccacacaaagagagctgagccagctgcaagagcttagc
aatcaccagaaaaagagggccactgagatcctgaatttgctgctgaaggatctgggggag
ataggaggaattattggcaccaatgatgtgaagactttggcagatgtgaatggagtcatt
gaggaggaattcaccatggcccggctgtacatcagcaagatgaagtcggaggttaaatct
ctggtgaaccgcagtaaacagctggagagcgcccagatggactccaacaggaagatgaat
gccagtgagcgggagctggcagcctgccagctgctcatctctcagcacgaagccaagatc
aaatccctgacagactacatgcagaacatggaacagaagaggaggcagctggaagagtcc
caagactcgctcagtgaagagctggccaagctccgagcccaagaaaaaatgcatgaagtc
agcttccaggataaagaaaaggaacatctgacccggctgcaggatgctgaggaaatgaag
aaggcgctggagcagcagatggagagccaccgggaagctcatcagaagcagctgtccagg
ctccgagatgaaatcgaggagaagcagaaaatcatcgatgagattcgggatttgaatcag
aaactgcaactggaacaggagaagctcagttctgattataacaagctgaaaatagaggac
caagagagagaaatgaaactggaaaagctcttattgctcaatgataaaagagaacaagcc
agagaggacctcaaagggctggaggagacagtgtctcgagaactacagactctgcacaac
ctccgtaaactcttcgtccaggatctgaccgcccgggttaaaaaaagtgtagagctggac
aacgacgagggaggaggcagtgctgcccagaagcagaaaatttccttcctggagaataac
ctggagcagctcactaaggtccacaaacagctggtccgggacaacgcagacctgcgctgt
gagctgcccaagctggagaagcgcctgcgtgccacggccgagcgcgtcaaggcactggag
agcgcgctgaaggaggccaaggagaacgccatgcgggaccgcaagcgctaccagcaggag
gtggaccgcatcaaggaggctgtgcgagccaagaacatggccaggagggcccactcggcc
cagatcgccaagcccatccgccctggacactacccagcatcgtctccaacggccgtccac
gccatccgagggggaggaggcagctcttcaaacaccactcactaccagaaataa

DBGET integrated database retrieval system