KEGG   Physeter catodon (sperm whale): 102976706
Entry
102976706         CDS       T06011                                 

Gene name
IKBKB
Definition
(RefSeq) inhibitor of nuclear factor kappa-B kinase subunit beta isoform X1
  KO
K07209  inhibitor of nuclear factor kappa-B kinase subunit beta [EC:2.7.11.10]
Organism
pcad  Physeter catodon (sperm whale)
Pathway
pcad01523  Antifolate resistance
pcad04010  MAPK signaling pathway
pcad04014  Ras signaling pathway
pcad04062  Chemokine signaling pathway
pcad04064  NF-kappa B signaling pathway
pcad04068  FoxO signaling pathway
pcad04150  mTOR signaling pathway
pcad04151  PI3K-Akt signaling pathway
pcad04210  Apoptosis
pcad04380  Osteoclast differentiation
pcad04620  Toll-like receptor signaling pathway
pcad04621  NOD-like receptor signaling pathway
pcad04622  RIG-I-like receptor signaling pathway
pcad04623  Cytosolic DNA-sensing pathway
pcad04625  C-type lectin receptor signaling pathway
pcad04657  IL-17 signaling pathway
pcad04658  Th1 and Th2 cell differentiation
pcad04659  Th17 cell differentiation
pcad04660  T cell receptor signaling pathway
pcad04662  B cell receptor signaling pathway
pcad04668  TNF signaling pathway
pcad04722  Neurotrophin signaling pathway
pcad04910  Insulin signaling pathway
pcad04920  Adipocytokine signaling pathway
pcad04930  Type II diabetes mellitus
pcad04931  Insulin resistance
pcad04932  Non-alcoholic fatty liver disease
pcad05010  Alzheimer disease
pcad05132  Salmonella infection
pcad05135  Yersinia infection
pcad05142  Chagas disease
pcad05145  Toxoplasmosis
pcad05160  Hepatitis C
pcad05161  Hepatitis B
pcad05162  Measles
pcad05163  Human cytomegalovirus infection
pcad05164  Influenza A
pcad05165  Human papillomavirus infection
pcad05166  Human T-cell leukemia virus 1 infection
pcad05167  Kaposi sarcoma-associated herpesvirus infection
pcad05168  Herpes simplex virus 1 infection
pcad05169  Epstein-Barr virus infection
pcad05170  Human immunodeficiency virus 1 infection
pcad05171  Coronavirus disease - COVID-19
pcad05200  Pathways in cancer
pcad05206  MicroRNAs in cancer
pcad05212  Pancreatic cancer
pcad05215  Prostate cancer
pcad05220  Chronic myeloid leukemia
pcad05221  Acute myeloid leukemia
pcad05222  Small cell lung cancer
pcad05235  PD-L1 expression and PD-1 checkpoint pathway in cancer
pcad05418  Fluid shear stress and atherosclerosis
Brite
KEGG Orthology (KO) [BR:pcad00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04010 MAPK signaling pathway
    102976706 (IKBKB)
   04014 Ras signaling pathway
    102976706 (IKBKB)
   04064 NF-kappa B signaling pathway
    102976706 (IKBKB)
   04668 TNF signaling pathway
    102976706 (IKBKB)
   04068 FoxO signaling pathway
    102976706 (IKBKB)
   04151 PI3K-Akt signaling pathway
    102976706 (IKBKB)
   04150 mTOR signaling pathway
    102976706 (IKBKB)
 09140 Cellular Processes
  09143 Cell growth and death
   04210 Apoptosis
    102976706 (IKBKB)
 09150 Organismal Systems
  09151 Immune system
   04620 Toll-like receptor signaling pathway
    102976706 (IKBKB)
   04621 NOD-like receptor signaling pathway
    102976706 (IKBKB)
   04622 RIG-I-like receptor signaling pathway
    102976706 (IKBKB)
   04623 Cytosolic DNA-sensing pathway
    102976706 (IKBKB)
   04625 C-type lectin receptor signaling pathway
    102976706 (IKBKB)
   04660 T cell receptor signaling pathway
    102976706 (IKBKB)
   04658 Th1 and Th2 cell differentiation
    102976706 (IKBKB)
   04659 Th17 cell differentiation
    102976706 (IKBKB)
   04657 IL-17 signaling pathway
    102976706 (IKBKB)
   04662 B cell receptor signaling pathway
    102976706 (IKBKB)
   04062 Chemokine signaling pathway
    102976706 (IKBKB)
  09152 Endocrine system
   04910 Insulin signaling pathway
    102976706 (IKBKB)
   04920 Adipocytokine signaling pathway
    102976706 (IKBKB)
  09156 Nervous system
   04722 Neurotrophin signaling pathway
    102976706 (IKBKB)
  09158 Development and regeneration
   04380 Osteoclast differentiation
    102976706 (IKBKB)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    102976706 (IKBKB)
   05206 MicroRNAs in cancer
    102976706 (IKBKB)
   05235 PD-L1 expression and PD-1 checkpoint pathway in cancer
    102976706 (IKBKB)
  09162 Cancer: specific types
   05212 Pancreatic cancer
    102976706 (IKBKB)
   05221 Acute myeloid leukemia
    102976706 (IKBKB)
   05220 Chronic myeloid leukemia
    102976706 (IKBKB)
   05215 Prostate cancer
    102976706 (IKBKB)
   05222 Small cell lung cancer
    102976706 (IKBKB)
  09164 Neurodegenerative disease
   05010 Alzheimer disease
    102976706 (IKBKB)
  09166 Cardiovascular disease
   05418 Fluid shear stress and atherosclerosis
    102976706 (IKBKB)
  09167 Endocrine and metabolic disease
   04930 Type II diabetes mellitus
    102976706 (IKBKB)
   04932 Non-alcoholic fatty liver disease
    102976706 (IKBKB)
   04931 Insulin resistance
    102976706 (IKBKB)
  09171 Infectious disease: bacterial
   05132 Salmonella infection
    102976706 (IKBKB)
   05135 Yersinia infection
    102976706 (IKBKB)
  09172 Infectious disease: viral
   05166 Human T-cell leukemia virus 1 infection
    102976706 (IKBKB)
   05170 Human immunodeficiency virus 1 infection
    102976706 (IKBKB)
   05161 Hepatitis B
    102976706 (IKBKB)
   05160 Hepatitis C
    102976706 (IKBKB)
   05171 Coronavirus disease - COVID-19
    102976706 (IKBKB)
   05164 Influenza A
    102976706 (IKBKB)
   05162 Measles
    102976706 (IKBKB)
   05168 Herpes simplex virus 1 infection
    102976706 (IKBKB)
   05163 Human cytomegalovirus infection
    102976706 (IKBKB)
   05167 Kaposi sarcoma-associated herpesvirus infection
    102976706 (IKBKB)
   05169 Epstein-Barr virus infection
    102976706 (IKBKB)
   05165 Human papillomavirus infection
    102976706 (IKBKB)
  09174 Infectious disease: parasitic
   05145 Toxoplasmosis
    102976706 (IKBKB)
   05142 Chagas disease
    102976706 (IKBKB)
  09176 Drug resistance: antineoplastic
   01523 Antifolate resistance
    102976706 (IKBKB)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01001 Protein kinases [BR:pcad01001]
    102976706 (IKBKB)
Enzymes [BR:pcad01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.11  Protein-serine/threonine kinases
    2.7.11.10  IkappaB kinase
     102976706 (IKBKB)
Protein kinases [BR:pcad01001]
 Serine/threonine kinases: Other
  IKK family [OT]
   102976706 (IKBKB)
SSDB
Motif
Pfam: IKBKB_SDD Pkinase PK_Tyr_Ser-Thr Pkinase_fungal IKKbetaNEMObind Kdo ubiquitin APH YrbL-PhoP_reg Med20
Other DBs
NCBI-GeneID: 102976706
NCBI-ProteinID: XP_028341955
UniProt: A0A455AZ89
LinkDB
Position
Unknown
AA seq 771 aa
MSWSPSLPTQTCGAWEMKERLGTGGFGNVIRWHNQETGEQIAIKQCRQELSPRNRERWCL
EIQIMRRLNHPNVVAARDVPEGMQSLAPNDLPLLAMEYCQGGDLRKYLNQFENCCGLREG
AILTLLSDIASALRYLHENRIIHRDLKPENIVLQQGEQRLIHKIIDLGYAKELDQGSLCT
SFVGTLQYLAPELLEQQKYTVTVDYWSFGTLAFECITGFRPFLPNWQPVQWHSKVRQKSE
MDIVVSEDLNGAVKFSSSLPHPSNLNSVLAQRLEKWLQLMLMWHPRQRGTDPIYGPNGCF
KALDDILNLKLVHVLNMVTGTIHTYPVAEDESLPSLKARIQQDTGIPEEDQELLQEAGLA
LTPDKPAAQCTSDGKLNEGRTLDMDLVFLFDNSRVAYETQISPRPQPESVSCILQEPKRS
LPFFQLRKVWGQVWHSIQALKEDCGRLQQGQRAAMMNLLRNNSCLSKMKNSMASMSQQLK
AKLDFFKTSIQIDLEKYSEQKEFGITSDKLLLAWREMEQAVELCGRENEVKHLVERMMAL
QTDIVDLQRSPLGRKQGGTLDDLEEQARELYRRLREKPRDQRTDGDSQEMVRLLLQAIQG
FEKKVRVIYTQLSKTVVCKQKALELLPKVEEVVSLMGEDEKTVVRLQEKRQKELWNLLKV
ACSKVRGPVSGSPDSMNTSRLSHPSQLLSQPCPAPDSLPEAVKKSEDLVAEAHALCAQLE
NALQDTMKEQDQSLRVMARGSPRCSTPFLPTANEKKQIERWCRASSISVYT
NT seq 2316 nt   +upstreamnt  +downstreamnt
atgagctggtcaccttccctgccaacccagacatgcggggcctgggaaatgaaagaacgg
cttgggacagggggatttgggaacgtcatccgatggcataaccaggaaacgggcgagcag
atcgctatcaagcagtgccggcaggagcttagtccccggaaccgcgagcgctggtgcctg
gagatccagatcatgaggaggctgaaccaccccaacgtggtggccgcccgggacgtccct
gagggcatgcagagcctggctcccaacgacctgcccctgctggccatggagtactgccag
ggaggggacctgcggaagtacctgaaccagtttgagaactgctgtggcctgcgggaagga
gccatcctcaccctgctgagcgacatcgcctctgcacttagataccttcacgaaaacagg
atcatccatcgggatctaaagccagaaaacatcgtcctgcagcaaggggaacagagattg
atacacaaaattattgacctaggatatgccaaggagctggaccagggtagtctgtgcact
tcctttgtggggaccctgcagtacctggcccctgagctgctagagcagcagaagtacacg
gtgaccgtggactactggagcttcggcaccttggccttcgagtgtatcacgggctttcgg
cccttcctgcccaactggcagcccgtgcagtggcactccaaagtccggcagaagagtgag
atggacatcgtggtgagtgaggacctgaacggagccgtgaagttctccagctcgttaccc
cacccgagcaacctcaacagcgtcctggcccagcggctggagaagtggctgcagctgatg
ctgatgtggcacccccgacagaggggcaccgaccccatctacgggcccaatggctgcttc
aaggccctggatgacatcttaaacttgaagctggttcacgtcttgaacatggtcacgggc
accattcacacctaccccgtggcagaggacgagagtctgcctagcttgaaggcccggatc
cagcaggacacaggcatccccgaggaggaccaggagctgctgcaggaagcgggtctggcc
ttgacccccgacaagcccgccgctcagtgcacctccgacggcaagctgaacgagggccgc
accctggacatggatctcgttttcctctttgacaacagcagggtcgcctatgagacccag
atctccccacggccccagcctgaaagcgtcagctgtatcttgcaagagcccaagaggagc
ctcccgttcttccagctgaggaaggtgtggggtcaggtctggcacagcatccaggccctg
aaggaggactgcggccgcctgcagcagggccagcgcgccgccatgatgaatctgctccgg
aacaacagctgcctctccaagatgaagaattccatggcctccatgtctcagcagctcaag
gccaagctggatttctttaaaaccagcatccagattgacctggagaagtacagcgagcag
aaggagtttgggatcacgtcagacaagctgctgctggcctggagggagatggagcaggcc
gtggagctctgtggacgggagaacgaggtgaagcacttggtggagcggatgatggcgctg
cagaccgacatcgtggacctgcagcgcagccccctgggccggaagcagggcgggacgctg
gacgacctagaagagcaggcgcgggagctttaccggaggctgagggagaagccccgagac
cagcgaactgacggcgacagtcaggaaatggtacggctgctcctgcaggcaatccaaggc
tttgagaagaaagtgcgagtgatctatacgcagctcagtaagactgtggtctgcaagcag
aaggccctggagctgctgcccaaggtggaggaggtggtgagcttaatgggcgaggatgag
aagactgtggttcggctgcaggagaagcgacagaaggagctctggaacctcctgaaggtc
gcttgtagcaaggtccgaggtcccgtcagcggaagtccggacagcatgaacacgtcccgc
ctgagtcaccccagccagctgctgtcgcagccttgcccagcccctgacagcttacccgag
gccgtcaagaagagcgaagacctcgtggctgaagcacacgccctgtgcgcgcagctggaa
aacgccctgcaggacaccatgaaggagcaggaccagagcttaagggtaatggcccgtggg
agcccccgctgctccacgcccttccttcctacagcaaacgagaaaaagcagatcgaaagg
tggtgccgtgcttcctcgatctcagtgtacacttag

KEGG   Physeter catodon (sperm whale): 102977668
Entry
102977668         CDS       T06011                                 

Gene name
CHUK
Definition
(RefSeq) inhibitor of nuclear factor kappa-B kinase subunit alpha isoform X2
  KO
K04467  inhibitor of nuclear factor kappa-B kinase subunit alpha [EC:2.7.11.10]
Organism
pcad  Physeter catodon (sperm whale)
Pathway
pcad01523  Antifolate resistance
pcad04010  MAPK signaling pathway
pcad04014  Ras signaling pathway
pcad04062  Chemokine signaling pathway
pcad04064  NF-kappa B signaling pathway
pcad04068  FoxO signaling pathway
pcad04150  mTOR signaling pathway
pcad04151  PI3K-Akt signaling pathway
pcad04210  Apoptosis
pcad04380  Osteoclast differentiation
pcad04620  Toll-like receptor signaling pathway
pcad04621  NOD-like receptor signaling pathway
pcad04622  RIG-I-like receptor signaling pathway
pcad04623  Cytosolic DNA-sensing pathway
pcad04625  C-type lectin receptor signaling pathway
pcad04657  IL-17 signaling pathway
pcad04658  Th1 and Th2 cell differentiation
pcad04659  Th17 cell differentiation
pcad04660  T cell receptor signaling pathway
pcad04662  B cell receptor signaling pathway
pcad04668  TNF signaling pathway
pcad04920  Adipocytokine signaling pathway
pcad05010  Alzheimer disease
pcad05132  Salmonella infection
pcad05135  Yersinia infection
pcad05142  Chagas disease
pcad05145  Toxoplasmosis
pcad05160  Hepatitis C
pcad05161  Hepatitis B
pcad05162  Measles
pcad05163  Human cytomegalovirus infection
pcad05164  Influenza A
pcad05165  Human papillomavirus infection
pcad05166  Human T-cell leukemia virus 1 infection
pcad05167  Kaposi sarcoma-associated herpesvirus infection
pcad05168  Herpes simplex virus 1 infection
pcad05169  Epstein-Barr virus infection
pcad05170  Human immunodeficiency virus 1 infection
pcad05171  Coronavirus disease - COVID-19
pcad05200  Pathways in cancer
pcad05212  Pancreatic cancer
pcad05215  Prostate cancer
pcad05220  Chronic myeloid leukemia
pcad05221  Acute myeloid leukemia
pcad05222  Small cell lung cancer
pcad05235  PD-L1 expression and PD-1 checkpoint pathway in cancer
pcad05418  Fluid shear stress and atherosclerosis
Brite
KEGG Orthology (KO) [BR:pcad00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04010 MAPK signaling pathway
    102977668 (CHUK)
   04014 Ras signaling pathway
    102977668 (CHUK)
   04064 NF-kappa B signaling pathway
    102977668 (CHUK)
   04668 TNF signaling pathway
    102977668 (CHUK)
   04068 FoxO signaling pathway
    102977668 (CHUK)
   04151 PI3K-Akt signaling pathway
    102977668 (CHUK)
   04150 mTOR signaling pathway
    102977668 (CHUK)
 09140 Cellular Processes
  09143 Cell growth and death
   04210 Apoptosis
    102977668 (CHUK)
 09150 Organismal Systems
  09151 Immune system
   04620 Toll-like receptor signaling pathway
    102977668 (CHUK)
   04621 NOD-like receptor signaling pathway
    102977668 (CHUK)
   04622 RIG-I-like receptor signaling pathway
    102977668 (CHUK)
   04623 Cytosolic DNA-sensing pathway
    102977668 (CHUK)
   04625 C-type lectin receptor signaling pathway
    102977668 (CHUK)
   04660 T cell receptor signaling pathway
    102977668 (CHUK)
   04658 Th1 and Th2 cell differentiation
    102977668 (CHUK)
   04659 Th17 cell differentiation
    102977668 (CHUK)
   04657 IL-17 signaling pathway
    102977668 (CHUK)
   04662 B cell receptor signaling pathway
    102977668 (CHUK)
   04062 Chemokine signaling pathway
    102977668 (CHUK)
  09152 Endocrine system
   04920 Adipocytokine signaling pathway
    102977668 (CHUK)
  09158 Development and regeneration
   04380 Osteoclast differentiation
    102977668 (CHUK)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    102977668 (CHUK)
   05235 PD-L1 expression and PD-1 checkpoint pathway in cancer
    102977668 (CHUK)
  09162 Cancer: specific types
   05212 Pancreatic cancer
    102977668 (CHUK)
   05221 Acute myeloid leukemia
    102977668 (CHUK)
   05220 Chronic myeloid leukemia
    102977668 (CHUK)
   05215 Prostate cancer
    102977668 (CHUK)
   05222 Small cell lung cancer
    102977668 (CHUK)
  09164 Neurodegenerative disease
   05010 Alzheimer disease
    102977668 (CHUK)
  09166 Cardiovascular disease
   05418 Fluid shear stress and atherosclerosis
    102977668 (CHUK)
  09171 Infectious disease: bacterial
   05132 Salmonella infection
    102977668 (CHUK)
   05135 Yersinia infection
    102977668 (CHUK)
  09172 Infectious disease: viral
   05166 Human T-cell leukemia virus 1 infection
    102977668 (CHUK)
   05170 Human immunodeficiency virus 1 infection
    102977668 (CHUK)
   05161 Hepatitis B
    102977668 (CHUK)
   05160 Hepatitis C
    102977668 (CHUK)
   05171 Coronavirus disease - COVID-19
    102977668 (CHUK)
   05164 Influenza A
    102977668 (CHUK)
   05162 Measles
    102977668 (CHUK)
   05168 Herpes simplex virus 1 infection
    102977668 (CHUK)
   05163 Human cytomegalovirus infection
    102977668 (CHUK)
   05167 Kaposi sarcoma-associated herpesvirus infection
    102977668 (CHUK)
   05169 Epstein-Barr virus infection
    102977668 (CHUK)
   05165 Human papillomavirus infection
    102977668 (CHUK)
  09174 Infectious disease: parasitic
   05145 Toxoplasmosis
    102977668 (CHUK)
   05142 Chagas disease
    102977668 (CHUK)
  09176 Drug resistance: antineoplastic
   01523 Antifolate resistance
    102977668 (CHUK)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01001 Protein kinases [BR:pcad01001]
    102977668 (CHUK)
Enzymes [BR:pcad01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.11  Protein-serine/threonine kinases
    2.7.11.10  IkappaB kinase
     102977668 (CHUK)
Protein kinases [BR:pcad01001]
 Serine/threonine kinases: Other
  IKK family [OT]
   102977668 (CHUK)
SSDB
Motif
Pfam: IKBKB_SDD Pkinase PK_Tyr_Ser-Thr IKKbetaNEMObind Pkinase_fungal Kdo TBK1_ULD
Other DBs
NCBI-GeneID: 102977668
NCBI-ProteinID: XP_007117682
UniProt: A0A2Y9F901
LinkDB
Position
20
AA seq 744 aa
MERPPGLRPGAGGPWEMRERLGTGGFGNVCLYQHRELDLKIAIKSCRLELSTKNRERWCH
EIQIMKKLNHANVVKACDVPEELNFLINDVPLLAMEYCSGGDLRKLLNKPENCCGLKESQ
ILSLLSDIGSGIRYLHENKIIHRDLKPENIVLQDVGGKIMHKIIDLGYAKDVDQGSLCTS
FVGTLQYLAPELFENKPYTATVDYWSFGTMVFECIAGYRPFLHHLQPFTWHEKIKKKDPK
CIFACEEMTGEVRFSSHLPQPNSLCSLIVEPMENWLQLMLNWDPQQRGGPIDLTLKQPRC
FVLMDHILNLKIVHILNMTSAKIISFLLPPDESLHSLQSRIERETGINTGSQELLSETGI
SLDPRKPASQCVLDGVRGCDSYMVYLFDKSKTVYEGPFASRSLSDCVNYIVQDSKIQLPI
IQLRKVWAEAVHYVSGLKEDYSRLFQGQRAAMLSLLRYNANLTKMKNTLISASQQLKAKL
EFFHKSIQLDLERYSEQMTYGISSEKMLKAWKEMEEKAIHYAEVGVIGYLEDQIMSLHTE
IMELQKSPYGRRQGDLMESLEQRAIDLYKQLKHRPSDHSYSDSTEMVKIIVHTVQSQDRV
LKELFGHLSKLLGCKQKIIDLLPKVEMALSDIKEADNTVMFMQGKRQKEIWHLLKIACTQ
SSARSLVGSSLEAVTPQASAWLPTTSAEREHPLSCVVTPQDGETLAQIIEENLNCLGHLS
TIMHEANEKQGNSMMNLDWSWLTE
NT seq 2235 nt   +upstreamnt  +downstreamnt
atggagcggcccccggggctgcggccgggcgcgggcgggccctgggagatgcgggagcgg
ctgggcaccggcggcttcgggaatgtttgcctgtaccaacatcgggaacttgatctcaaa
atagcaattaagtcttgtcgtctggagctaagcaccaaaaacagagaacggtggtgccat
gaaatccagatcatgaagaagttgaaccacgccaatgttgtaaaggcctgtgatgttcct
gaggaattgaattttttgattaatgatgtgcctcttctagcaatggaatattgttctgga
ggagatctccggaagctactcaacaaaccagaaaattgctgtggacttaaagaaagtcag
atactttctttactgagtgatataggatctgggatacgatatttgcatgaaaacaaaatt
atacatcgtgatctaaaacctgaaaacatagttcttcaggatgttggtggaaagattatg
cataaaataattgatttaggatatgccaaagatgttgatcaaggaagtctgtgtacatcc
tttgtgggaacattgcagtatctggccccagagctctttgagaataagccttacacagcc
actgttgattattggagctttgggaccatggtgtttgagtgtattgctgggtataggcct
tttttgcatcatctgcagccatttacctggcatgagaagattaagaagaaggatccaaag
tgtatatttgcatgcgaagagatgacaggagaagttcggtttagtagccatttacctcaa
ccaaatagcctttgtagtttaatagtagaacccatggaaaactggctacagttgatgctg
aactgggatcctcagcagagaggaggacctattgatcttactttgaagcagccaagatgt
tttgtattaatggatcacattctgaatttgaagatagtacacatcctaaatatgacttct
gcaaagatcatttcttttctgttaccacctgatgaaagtcttcattcactacagtctcgt
attgagcgtgaaactggaataaatactggttctcaagagcttctttcagagacgggaatt
tctttggatcctcggaaaccagcctctcagtgtgttttggatggagttaggggctgtgat
agctatatggtttatttgtttgataaaagtaagactgtatatgaaggaccatttgcttcc
agaagtttatctgactgtgtaaattatattgtacaggacagcaaaatacagcttccaatt
atacagctgcgtaaagtatgggccgaagcagtgcactatgtgtctgggctaaaagaagac
tatagcaggctctttcagggacagagagcagcaatgttaagtcttcttagatataatgct
aacttgacaaaaatgaagaacactttaatctcagcatctcagcaactgaaagctaaattg
gagttttttcacaaaagcattcagcttgacttggaaagatatagtgagcagatgacttat
gggatatcctcagaaaaaatgttaaaagcatggaaagaaatggaagaaaaggctatccac
tatgctgaggtgggtgtcattggatacctggaggatcagatcatgtccctgcacactgaa
atcatggagctacagaagagcccctatggacgacgtcagggagacttgatggaatctctg
gaacagcgtgccattgatctatataagcagttaaagcacagaccttcagatcactcctac
agcgacagcacggagatggtgaaaatcattgtgcatactgtgcagagtcaggaccgggtt
ctcaaggagctgttcggtcatttgagcaagttgttgggctgtaagcagaagattattgat
ctactgcccaaggtggaaatggccctcagtgacatcaaagaagctgacaatactgtcatg
tttatgcagggaaagaggcagaaagaaatatggcatcttcttaaaattgcttgtacacag
agctctgctcggtcccttgtaggatccagtctagaagctgtaacccctcaggcatcagca
tggctgcccacaacttcagcagaacgtgaacatcctctgtcatgcgtggtaactcctcaa
gatggggagactttagcacaaataatagaagaaaatttgaactgtcttggccatttaagc
actattatgcatgaagcaaatgagaaacagggcaacagtatgatgaatcttgattggagt
tggttaacagaatga

KEGG   Physeter catodon (sperm whale): 102980964
Entry
102980964         CDS       T06011                                 

Gene name
IKBKG
Definition
(RefSeq) NF-kappa-B essential modulator
  KO
K07210  inhibitor of nuclear factor kappa-B kinase subunit gamma
Organism
pcad  Physeter catodon (sperm whale)
Pathway
pcad01523  Antifolate resistance
pcad04010  MAPK signaling pathway
pcad04014  Ras signaling pathway
pcad04062  Chemokine signaling pathway
pcad04064  NF-kappa B signaling pathway
pcad04151  PI3K-Akt signaling pathway
pcad04210  Apoptosis
pcad04380  Osteoclast differentiation
pcad04620  Toll-like receptor signaling pathway
pcad04621  NOD-like receptor signaling pathway
pcad04622  RIG-I-like receptor signaling pathway
pcad04623  Cytosolic DNA-sensing pathway
pcad04625  C-type lectin receptor signaling pathway
pcad04657  IL-17 signaling pathway
pcad04658  Th1 and Th2 cell differentiation
pcad04659  Th17 cell differentiation
pcad04660  T cell receptor signaling pathway
pcad04662  B cell receptor signaling pathway
pcad04668  TNF signaling pathway
pcad04920  Adipocytokine signaling pathway
pcad05132  Salmonella infection
pcad05135  Yersinia infection
pcad05142  Chagas disease
pcad05145  Toxoplasmosis
pcad05160  Hepatitis C
pcad05161  Hepatitis B
pcad05162  Measles
pcad05163  Human cytomegalovirus infection
pcad05164  Influenza A
pcad05165  Human papillomavirus infection
pcad05166  Human T-cell leukemia virus 1 infection
pcad05167  Kaposi sarcoma-associated herpesvirus infection
pcad05168  Herpes simplex virus 1 infection
pcad05169  Epstein-Barr virus infection
pcad05170  Human immunodeficiency virus 1 infection
pcad05171  Coronavirus disease - COVID-19
pcad05200  Pathways in cancer
pcad05203  Viral carcinogenesis
pcad05212  Pancreatic cancer
pcad05215  Prostate cancer
pcad05220  Chronic myeloid leukemia
pcad05221  Acute myeloid leukemia
pcad05222  Small cell lung cancer
pcad05235  PD-L1 expression and PD-1 checkpoint pathway in cancer
pcad05340  Primary immunodeficiency
pcad05418  Fluid shear stress and atherosclerosis
Brite
KEGG Orthology (KO) [BR:pcad00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04010 MAPK signaling pathway
    102980964 (IKBKG)
   04014 Ras signaling pathway
    102980964 (IKBKG)
   04064 NF-kappa B signaling pathway
    102980964 (IKBKG)
   04668 TNF signaling pathway
    102980964 (IKBKG)
   04151 PI3K-Akt signaling pathway
    102980964 (IKBKG)
 09140 Cellular Processes
  09143 Cell growth and death
   04210 Apoptosis
    102980964 (IKBKG)
 09150 Organismal Systems
  09151 Immune system
   04620 Toll-like receptor signaling pathway
    102980964 (IKBKG)
   04621 NOD-like receptor signaling pathway
    102980964 (IKBKG)
   04622 RIG-I-like receptor signaling pathway
    102980964 (IKBKG)
   04623 Cytosolic DNA-sensing pathway
    102980964 (IKBKG)
   04625 C-type lectin receptor signaling pathway
    102980964 (IKBKG)
   04660 T cell receptor signaling pathway
    102980964 (IKBKG)
   04658 Th1 and Th2 cell differentiation
    102980964 (IKBKG)
   04659 Th17 cell differentiation
    102980964 (IKBKG)
   04657 IL-17 signaling pathway
    102980964 (IKBKG)
   04662 B cell receptor signaling pathway
    102980964 (IKBKG)
   04062 Chemokine signaling pathway
    102980964 (IKBKG)
  09152 Endocrine system
   04920 Adipocytokine signaling pathway
    102980964 (IKBKG)
  09158 Development and regeneration
   04380 Osteoclast differentiation
    102980964 (IKBKG)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    102980964 (IKBKG)
   05203 Viral carcinogenesis
    102980964 (IKBKG)
   05235 PD-L1 expression and PD-1 checkpoint pathway in cancer
    102980964 (IKBKG)
  09162 Cancer: specific types
   05212 Pancreatic cancer
    102980964 (IKBKG)
   05221 Acute myeloid leukemia
    102980964 (IKBKG)
   05220 Chronic myeloid leukemia
    102980964 (IKBKG)
   05215 Prostate cancer
    102980964 (IKBKG)
   05222 Small cell lung cancer
    102980964 (IKBKG)
  09163 Immune disease
   05340 Primary immunodeficiency
    102980964 (IKBKG)
  09166 Cardiovascular disease
   05418 Fluid shear stress and atherosclerosis
    102980964 (IKBKG)
  09171 Infectious disease: bacterial
   05132 Salmonella infection
    102980964 (IKBKG)
   05135 Yersinia infection
    102980964 (IKBKG)
  09172 Infectious disease: viral
   05166 Human T-cell leukemia virus 1 infection
    102980964 (IKBKG)
   05170 Human immunodeficiency virus 1 infection
    102980964 (IKBKG)
   05161 Hepatitis B
    102980964 (IKBKG)
   05160 Hepatitis C
    102980964 (IKBKG)
   05171 Coronavirus disease - COVID-19
    102980964 (IKBKG)
   05164 Influenza A
    102980964 (IKBKG)
   05162 Measles
    102980964 (IKBKG)
   05168 Herpes simplex virus 1 infection
    102980964 (IKBKG)
   05163 Human cytomegalovirus infection
    102980964 (IKBKG)
   05167 Kaposi sarcoma-associated herpesvirus infection
    102980964 (IKBKG)
   05169 Epstein-Barr virus infection
    102980964 (IKBKG)
   05165 Human papillomavirus infection
    102980964 (IKBKG)
  09174 Infectious disease: parasitic
   05145 Toxoplasmosis
    102980964 (IKBKG)
   05142 Chagas disease
    102980964 (IKBKG)
  09176 Drug resistance: antineoplastic
   01523 Antifolate resistance
    102980964 (IKBKG)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01001 Protein kinases [BR:pcad01001]
    102980964 (IKBKG)
Protein kinases [BR:pcad01001]
 Serine/threonine kinases: Other
  IKK family [OT]
   102980964 (IKBKG)
SSDB
Motif
Pfam: CC2-LZ zf_C2H2_10 zf_C2H2_ZHX Exonuc_VII_L WXG100 SAM_Exu
Other DBs
NCBI-GeneID: 102980964
NCBI-ProteinID: XP_028338150
UniProt: A0A455ANA1
LinkDB
Position
21
AA seq 270 aa
LVPASARHGGDAGSTGGSCCGPSVTPHALARARAASEQARQLENEREALQQQHSVQVDQL
RLQNQSMDAALRMERQAASEEKRKLAQLQVAYHQLFQEYDNHIKSSVGLQLEELKQQLKQ
AEEALVAKQELIDKLKEEAEQHRVVMETVPVLKAQADIYKADFQAERQARERLAEKKELL
QEQLQQLRRGYSRLRGGCQDSARIEDMRKRHVEVSQPPLAPGPAHHSFHLALPSQRRSPP
EEPPNFCCPKCQYQAPDMDTLQIHVMECIE
NT seq 813 nt   +upstreamnt  +downstreamnt
cttgtccctgcctctgcgcggcatggcggggatgccgggagcacaggagggtcctgctgt
gggccctccgtgaccccccatgccctcgccagggcgcgggccgccagcgagcaggcccgg
cagctggagaacgagcgcgaggcgctgcagcagcagcacagcgtgcaggtggaccagctg
cgcctgcagaaccagagcatggacgctgccctgcgcatggagcgccaggctgcctcggag
gagaagaggaagctggcccagctgcaggtggcctatcaccagctcttccaagagtatgac
aaccacatcaagagcagcgtgggattgcagctggaagagctcaagcagcagctcaagcag
gccgaggaggccctggtggccaaacaggagctgatcgacaaactgaaggaagaggctgaa
cagcacagggtggtgatggagacggtcccggtgctgaaagcccaggcggatatctacaag
gcagatttccaggctgagaggcaggcccgggagaggctggccgagaagaaggagctcctg
caggagcagctgcagcagctgcggaggggctacagcaggctgaggggcggctgccaggac
tcggccaggatcgaagacatgaggaagcggcatgtagaggtctcccagccccccttagcc
ccgggcccagctcatcactcctttcacctggccctgcccagccagaggagaagcccccct
gaggagccgcccaacttctgctgccccaagtgccagtatcaggctcctgacatggacacc
ctgcagatacacgtcatggagtgcatcgagtag

KEGG   Physeter catodon (sperm whale): 114485485
Entry
114485485         CDS       T06011                                 

Definition
(RefSeq) NF-kappa-B essential modulator-like isoform X1
  KO
K07210  inhibitor of nuclear factor kappa-B kinase subunit gamma
Organism
pcad  Physeter catodon (sperm whale)
Pathway
pcad01523  Antifolate resistance
pcad04010  MAPK signaling pathway
pcad04014  Ras signaling pathway
pcad04062  Chemokine signaling pathway
pcad04064  NF-kappa B signaling pathway
pcad04151  PI3K-Akt signaling pathway
pcad04210  Apoptosis
pcad04380  Osteoclast differentiation
pcad04620  Toll-like receptor signaling pathway
pcad04621  NOD-like receptor signaling pathway
pcad04622  RIG-I-like receptor signaling pathway
pcad04623  Cytosolic DNA-sensing pathway
pcad04625  C-type lectin receptor signaling pathway
pcad04657  IL-17 signaling pathway
pcad04658  Th1 and Th2 cell differentiation
pcad04659  Th17 cell differentiation
pcad04660  T cell receptor signaling pathway
pcad04662  B cell receptor signaling pathway
pcad04668  TNF signaling pathway
pcad04920  Adipocytokine signaling pathway
pcad05132  Salmonella infection
pcad05135  Yersinia infection
pcad05142  Chagas disease
pcad05145  Toxoplasmosis
pcad05160  Hepatitis C
pcad05161  Hepatitis B
pcad05162  Measles
pcad05163  Human cytomegalovirus infection
pcad05164  Influenza A
pcad05165  Human papillomavirus infection
pcad05166  Human T-cell leukemia virus 1 infection
pcad05167  Kaposi sarcoma-associated herpesvirus infection
pcad05168  Herpes simplex virus 1 infection
pcad05169  Epstein-Barr virus infection
pcad05170  Human immunodeficiency virus 1 infection
pcad05171  Coronavirus disease - COVID-19
pcad05200  Pathways in cancer
pcad05203  Viral carcinogenesis
pcad05212  Pancreatic cancer
pcad05215  Prostate cancer
pcad05220  Chronic myeloid leukemia
pcad05221  Acute myeloid leukemia
pcad05222  Small cell lung cancer
pcad05235  PD-L1 expression and PD-1 checkpoint pathway in cancer
pcad05340  Primary immunodeficiency
pcad05418  Fluid shear stress and atherosclerosis
Brite
KEGG Orthology (KO) [BR:pcad00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04010 MAPK signaling pathway
    114485485
   04014 Ras signaling pathway
    114485485
   04064 NF-kappa B signaling pathway
    114485485
   04668 TNF signaling pathway
    114485485
   04151 PI3K-Akt signaling pathway
    114485485
 09140 Cellular Processes
  09143 Cell growth and death
   04210 Apoptosis
    114485485
 09150 Organismal Systems
  09151 Immune system
   04620 Toll-like receptor signaling pathway
    114485485
   04621 NOD-like receptor signaling pathway
    114485485
   04622 RIG-I-like receptor signaling pathway
    114485485
   04623 Cytosolic DNA-sensing pathway
    114485485
   04625 C-type lectin receptor signaling pathway
    114485485
   04660 T cell receptor signaling pathway
    114485485
   04658 Th1 and Th2 cell differentiation
    114485485
   04659 Th17 cell differentiation
    114485485
   04657 IL-17 signaling pathway
    114485485
   04662 B cell receptor signaling pathway
    114485485
   04062 Chemokine signaling pathway
    114485485
  09152 Endocrine system
   04920 Adipocytokine signaling pathway
    114485485
  09158 Development and regeneration
   04380 Osteoclast differentiation
    114485485
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    114485485
   05203 Viral carcinogenesis
    114485485
   05235 PD-L1 expression and PD-1 checkpoint pathway in cancer
    114485485
  09162 Cancer: specific types
   05212 Pancreatic cancer
    114485485
   05221 Acute myeloid leukemia
    114485485
   05220 Chronic myeloid leukemia
    114485485
   05215 Prostate cancer
    114485485
   05222 Small cell lung cancer
    114485485
  09163 Immune disease
   05340 Primary immunodeficiency
    114485485
  09166 Cardiovascular disease
   05418 Fluid shear stress and atherosclerosis
    114485485
  09171 Infectious disease: bacterial
   05132 Salmonella infection
    114485485
   05135 Yersinia infection
    114485485
  09172 Infectious disease: viral
   05166 Human T-cell leukemia virus 1 infection
    114485485
   05170 Human immunodeficiency virus 1 infection
    114485485
   05161 Hepatitis B
    114485485
   05160 Hepatitis C
    114485485
   05171 Coronavirus disease - COVID-19
    114485485
   05164 Influenza A
    114485485
   05162 Measles
    114485485
   05168 Herpes simplex virus 1 infection
    114485485
   05163 Human cytomegalovirus infection
    114485485
   05167 Kaposi sarcoma-associated herpesvirus infection
    114485485
   05169 Epstein-Barr virus infection
    114485485
   05165 Human papillomavirus infection
    114485485
  09174 Infectious disease: parasitic
   05145 Toxoplasmosis
    114485485
   05142 Chagas disease
    114485485
  09176 Drug resistance: antineoplastic
   01523 Antifolate resistance
    114485485
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01001 Protein kinases [BR:pcad01001]
    114485485
Protein kinases [BR:pcad01001]
 Serine/threonine kinases: Other
  IKK family [OT]
   114485485
SSDB
Motif
Pfam: NEMO DUF1636 ZapB FUSC-like Bacillus_HBL RasGAP_C
Other DBs
NCBI-GeneID: 114485485
NCBI-ProteinID: XP_028342777
UniProt: A0A455B1Y5
LinkDB
Position
Unknown
AA seq 298 aa
MPPTERQGGMRVATHITGERPEGQRRLAGSGFGLRQPPSHLSPAGWGRGLSVLLPDPTAT
TPEAGSGSLAVGEGKGYRGTRVFSEHRGPRSARGRHSRLSHVGPTLLTGVVLFSEDRVPS
TLTCWMSRPPWKSPLCEMVQPSGGPAGDQGALGEESSLGKPAMLHLPSEQGAPETFQRCL
EENQELRDAIRQSNQMLRERCEELQRFQGSQREEKAFLMQKFQEARDLVERLSLEKRELH
RQREQALQELECLKTCQQQMAEDKASVKAQVTSLLGELQESQSRLEAATKERQALEGR
NT seq 897 nt   +upstreamnt  +downstreamnt
atgccgccgacggagagacaagggggaatgcgggtcgcgacgcatattactggggaacgt
cctgagggccagcggaggctggcgggctcgggtttcggtctgaggcagcctccctcacac
ctctcgccagccggctggggtcggggcctgagtgttttacttccggatcccacagctacg
acaccggaagccggaagtgggagtttggcagtgggagaagggaagggctaccgcggaacc
cgggttttttcggagcatcggggtccgaggagcgctcggggccgccactcccgcctttct
cacgtcggaccgactctgctgacaggtgtggtcctcttctccgaagacagggtaccatcg
accctgacgtgttggatgagcaggcccccctggaagagtccactgtgtgagatggtgcag
cctagcggcggcccagcaggggaccagggcgcactgggtgaagagtcttctctggggaag
ccagccatgcttcacctgccttcagagcagggtgctcctgagaccttccagcgctgtctg
gaggagaatcaagagctccgagacgccatccgccagagcaaccagatgctgcgggaacgc
tgcgaggagctgcagcgtttccagggcagccagagggaggagaaggccttcctcatgcag
aagttccaggaggcccgggacctggtggagaggctgagcctggagaagcgggagctgcac
cggcagagggagcaggccctgcaggagctggagtgcctcaagacatgccagcagcagatg
gccgaggacaaggcctcagtgaaagcccaggtgacgtccttgctgggggagctgcaggag
agccagagtcgcttggaggccgccaccaaggagaggcaggctttggagggcaggtga

DBGET integrated database retrieval system