KEGG   Physeter catodon (sperm whale): 102976764
Entry
102976764         CDS       T06011                                 

Gene name
STAT3
Definition
(RefSeq) signal transducer and activator of transcription 3 isoform X1
  KO
K04692  signal transducer and activator of transcription 3
Organism
pcad  Physeter catodon (sperm whale)
Pathway
pcad01521  EGFR tyrosine kinase inhibitor resistance
pcad04062  Chemokine signaling pathway
pcad04066  HIF-1 signaling pathway
pcad04068  FoxO signaling pathway
pcad04217  Necroptosis
pcad04550  Signaling pathways regulating pluripotency of stem cells
pcad04630  JAK-STAT signaling pathway
pcad04659  Th17 cell differentiation
pcad04917  Prolactin signaling pathway
pcad04920  Adipocytokine signaling pathway
pcad04931  Insulin resistance
pcad04933  AGE-RAGE signaling pathway in diabetic complications
pcad04935  Growth hormone synthesis, secretion and action
pcad05145  Toxoplasmosis
pcad05160  Hepatitis C
pcad05161  Hepatitis B
pcad05162  Measles
pcad05163  Human cytomegalovirus infection
pcad05167  Kaposi sarcoma-associated herpesvirus infection
pcad05169  Epstein-Barr virus infection
pcad05171  Coronavirus disease - COVID-19
pcad05200  Pathways in cancer
pcad05203  Viral carcinogenesis
pcad05205  Proteoglycans in cancer
pcad05206  MicroRNAs in cancer
pcad05212  Pancreatic cancer
pcad05221  Acute myeloid leukemia
pcad05223  Non-small cell lung cancer
pcad05235  PD-L1 expression and PD-1 checkpoint pathway in cancer
pcad05321  Inflammatory bowel disease
Brite
KEGG Orthology (KO) [BR:pcad00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04630 JAK-STAT signaling pathway
    102976764 (STAT3)
   04066 HIF-1 signaling pathway
    102976764 (STAT3)
   04068 FoxO signaling pathway
    102976764 (STAT3)
 09140 Cellular Processes
  09143 Cell growth and death
   04217 Necroptosis
    102976764 (STAT3)
  09144 Cellular community - eukaryotes
   04550 Signaling pathways regulating pluripotency of stem cells
    102976764 (STAT3)
 09150 Organismal Systems
  09151 Immune system
   04659 Th17 cell differentiation
    102976764 (STAT3)
   04062 Chemokine signaling pathway
    102976764 (STAT3)
  09152 Endocrine system
   04920 Adipocytokine signaling pathway
    102976764 (STAT3)
   04917 Prolactin signaling pathway
    102976764 (STAT3)
   04935 Growth hormone synthesis, secretion and action
    102976764 (STAT3)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    102976764 (STAT3)
   05206 MicroRNAs in cancer
    102976764 (STAT3)
   05205 Proteoglycans in cancer
    102976764 (STAT3)
   05203 Viral carcinogenesis
    102976764 (STAT3)
   05235 PD-L1 expression and PD-1 checkpoint pathway in cancer
    102976764 (STAT3)
  09162 Cancer: specific types
   05212 Pancreatic cancer
    102976764 (STAT3)
   05221 Acute myeloid leukemia
    102976764 (STAT3)
   05223 Non-small cell lung cancer
    102976764 (STAT3)
  09163 Immune disease
   05321 Inflammatory bowel disease
    102976764 (STAT3)
  09167 Endocrine and metabolic disease
   04931 Insulin resistance
    102976764 (STAT3)
   04933 AGE-RAGE signaling pathway in diabetic complications
    102976764 (STAT3)
  09172 Infectious disease: viral
   05161 Hepatitis B
    102976764 (STAT3)
   05160 Hepatitis C
    102976764 (STAT3)
   05171 Coronavirus disease - COVID-19
    102976764 (STAT3)
   05162 Measles
    102976764 (STAT3)
   05163 Human cytomegalovirus infection
    102976764 (STAT3)
   05167 Kaposi sarcoma-associated herpesvirus infection
    102976764 (STAT3)
   05169 Epstein-Barr virus infection
    102976764 (STAT3)
  09174 Infectious disease: parasitic
   05145 Toxoplasmosis
    102976764 (STAT3)
  09176 Drug resistance: antineoplastic
   01521 EGFR tyrosine kinase inhibitor resistance
    102976764 (STAT3)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03000 Transcription factors [BR:pcad03000]
    102976764 (STAT3)
Transcription factors [BR:pcad03000]
 Eukaryotic type
  beta-Scaffold factors with minor groove contacts
   STAT
    102976764 (STAT3)
SSDB
Motif
Pfam: STAT_alpha STAT_bind STAT_int SH2 E2R135 DUF4795 Syntaxin-6_N AP1AR Fib_alpha
Other DBs
NCBI-GeneID: 102976764
NCBI-ProteinID: XP_028354098
UniProt: A0A455C2E0
LinkDB
Position
14
AA seq 770 aa
MAQWNQLQQLDTRYLEQLHQLYSDSFPMELRQFLAPWIESQDWAYAASKESHATLVFHNL
LGEIDQQYSRFLQESNVLYQHNLRRIKQFLQSRYLEKPMEIARIVARCLWEESRLLQTAA
TAAQQGGQANHPTAAVVTEKQQMLEQHLQDVRKRVQDLEQKMKVVENLQDDFDFNYKTLK
SQGDMQDLNGNNQSVTRQKMQQLEQMLTALDQMRRSIVSELAGLLSAMEYVQKTLTDEEL
ADWKRRQQIACIGGPPNICLDRLENWITSLAESQLQTRQQIKKLEELQQKVSYKGDPIVQ
HRPMLEERIVELFRNLMKSAFVVERQPCMPMHPDRPLVIKTGVQFTTKVRLLVKFPELNY
QLKIKVCIDKDSGDVAALRGSRKFNILGTNTKVMNMEESNNGSLSAEFKHLTLREQRCGN
GGRANCDASLIVTEELHLITFETEVYHQGLKIDLETHSLPVVVISNICQMPNAWASILWY
NMLTNNPKNVNFFTKPPIGTWDQVAEVLSWQFSSTTKRGLSIEQLTTLAEKLLGPGVNYS
GCQITWAKFCKENMAGKGFSFWVWLDNIIDLVKKYILALWNEGYIMGFISKERERAILST
KPPGTFLLRFSESSKEGGVTFTWVEKDISGKTQIQSVEPYTKQQLNNMSFAEIIMGYKIM
DATNILVSPLVYLYPDIPKEEAFGKYCRPESQEHPEADPGSAAPYLKTKFICVTPTTCSN
TIDLPMSPRTLDSLMQFGNNGEGAEPSAGGQFESLTFDMELTSECATSPM
NT seq 2313 nt   +upstreamnt  +downstreamnt
atggcccaatggaatcagttacagcagctggacacacggtacttggagcagcttcatcag
ctgtacagtgacagcttcccgatggagctacggcagtttctggccccttggatcgagagt
caagattgggcatatgcggctagcaaagaatcacatgcaactttggtgtttcataatctc
ttgggtgaaattgaccagcagtatagccgcttcctgcaagagtccaatgttctctatcag
cacaacctgcgaagaatcaagcagttccttcagagcagataccttgagaagccaatggag
attgcccgaattgtggcccggtgcctgtgggaagagtcccgcctcctccaaactgcagcc
actgcagcccagcaagggggccaggccaaccatcccacagccgccgtggtgacggagaag
cagcaaatgctggagcaacacctacaggatgtccggaagcgtgtccaggatctagaacag
aaaatgaaagtggtagagaatctccaggatgactttgatttcaactacaaaaccctcaag
agtcaaggagatatgcaggatctgaatggaaacaaccagtcagtgaccaggcagaagatg
cagcagctcgaacagatgcttactgcgctggaccagatgcggcgaagcatcgtgagtgag
ttggcagggcttttgtcagctatggagtacgtgcagaaaacgctcacggatgaagagctg
gcggactggaagaggcggcagcagattgcttgcattggaggccctcccaacatctgccta
gatcggctagaaaactggataacctcattggcagaatctcaacttcagacccgccaacaa
attaagaaactggaggagttgcagcagaaagttagctacaaaggggatcccattgtacag
caccggccaatgctggaggagagaatcgtagagctgtttagaaacttaatgaaaagcgcc
ttcgtggtagagcggcagccctgcatgcctatgcatcctgaccggccattagtcatcaag
accggtgtccagtttacaactaaagtcagattgctggtcaaattccctgagctaaattat
cagcttaaaattaaagtgtgcattgacaaagactccggggatgttgcagctctcagagga
tcccggaaatttaacatcctgggcacaaacacgaaagtgatgaacatggaagagtccaac
aacggcagcctctccgcagagttcaaacacttgaccctgagagagcagagatgtggtaac
gggggccgagccaactgcgacgcctccctgatcgtgactgaggagctgcacctgatcacc
tttgagactgaggtgtatcaccaaggcctcaagattgacctggagacccactccttgcca
gttgtggtgatctccaacatctgtcagatgcccaacgcctgggcgtccatcctgtggtat
aacatgctgaccaacaaccccaagaacgtgaactttttcaccaagcccccaattggaacg
tgggatcaagtggccgaggtgctgagctggcagttctcctccaccaccaagcgtgggctg
agcatcgagcagttgacaacgctggcggagaaactcttaggacctggtgtgaactattca
gggtgtcagatcacgtgggctaaattttgcaaagaaaacatggccggcaagggcttctcc
ttctgggtctggctggacaatatcattgaccttgtgaaaaagtacatcctggccctttgg
aatgaagggtacataatgggctttatcagtaaggagagggagcgggccatcttgagcacc
aagcccccaggcaccttcctgctgagattcagtgaaagtagcaaagaaggaggagtcacc
ttcacttgggtggagaaggacatcagcggtaagacccagatccagtcggtggaaccatac
accaagcagcagctgaacaacatgtcgtttgctgaaatcatcatgggctataagatcatg
gatgccaccaatatcctcgtgtctccgctggtctatctctaccctgacattccaaaggag
gaggcgttcggaaagtactgtcggccagagagccaggagcatcccgaagctgacccaggt
agtgccgccccatacctgaagactaagttcatctgtgtgacaccaacgacctgcagcaat
accattgacctgccgatgtccccccgcactttagattcattgatgcagtttggaaataat
ggtgaaggtgctgaaccctcagcaggagggcagttcgaatccctcacgttcgacatggag
ctgacctcggagtgcgctacctcccccatgtga

KEGG   Physeter catodon (sperm whale): 102978994
Entry
102978994         CDS       T06011                                 

Definition
(RefSeq) signal transducer and activator of transcription 5A
  KO
K11223  signal transducer and activator of transcription 5A
Organism
pcad  Physeter catodon (sperm whale)
Pathway
pcad04012  ErbB signaling pathway
pcad04217  Necroptosis
pcad04630  JAK-STAT signaling pathway
pcad04658  Th1 and Th2 cell differentiation
pcad04659  Th17 cell differentiation
pcad04917  Prolactin signaling pathway
pcad04933  AGE-RAGE signaling pathway in diabetic complications
pcad04935  Growth hormone synthesis, secretion and action
pcad05161  Hepatitis B
pcad05162  Measles
pcad05166  Human T-cell leukemia virus 1 infection
pcad05200  Pathways in cancer
pcad05203  Viral carcinogenesis
pcad05220  Chronic myeloid leukemia
pcad05221  Acute myeloid leukemia
pcad05223  Non-small cell lung cancer
Brite
KEGG Orthology (KO) [BR:pcad00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04012 ErbB signaling pathway
    102978994
   04630 JAK-STAT signaling pathway
    102978994
 09140 Cellular Processes
  09143 Cell growth and death
   04217 Necroptosis
    102978994
 09150 Organismal Systems
  09151 Immune system
   04658 Th1 and Th2 cell differentiation
    102978994
   04659 Th17 cell differentiation
    102978994
  09152 Endocrine system
   04917 Prolactin signaling pathway
    102978994
   04935 Growth hormone synthesis, secretion and action
    102978994
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    102978994
   05203 Viral carcinogenesis
    102978994
  09162 Cancer: specific types
   05221 Acute myeloid leukemia
    102978994
   05220 Chronic myeloid leukemia
    102978994
   05223 Non-small cell lung cancer
    102978994
  09167 Endocrine and metabolic disease
   04933 AGE-RAGE signaling pathway in diabetic complications
    102978994
  09172 Infectious disease: viral
   05166 Human T-cell leukemia virus 1 infection
    102978994
   05161 Hepatitis B
    102978994
   05162 Measles
    102978994
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03000 Transcription factors [BR:pcad03000]
    102978994
Transcription factors [BR:pcad03000]
 Eukaryotic type
  beta-Scaffold factors with minor groove contacts
   STAT
    102978994
SSDB
Motif
Pfam: STAT_bind STAT_int STAT_alpha SH2
Other DBs
NCBI-GeneID: 102978994
NCBI-ProteinID: XP_023985945
UniProt: A0A2Y9TAN3
LinkDB
Position
14
AA seq 783 aa
MAGWIQAQQLQGDALRQMQVLYGQHFPIEVRHYLAQWIESQPWDAIDLDNPQDRPQATQL
LEGLVQELQKKAEHQVGEDGFLLKIKLGHYATQLQNTYDRCPMELVRCIRHILYNEQRLV
REANNGSSSSGILVDAMSQKHLQINQTLEELRLVTQDTENELKKLQQTQEYFIIQYQESL
RIQAQFSQLAQLNPQERLSRETALQQKQVSLEAWLQREAQTLQQYRVELAEKHQKTLQLL
RKQQTIILDDELIQWKRRQQLAGNGGPPEGSLDVLQSWSYFTSGLVPAAGFGAPVLCHLP
REGRPWVRECDTYLNISSREEIIEKQPPQVLKTQTKFAATVRLLVGGKLNVHMNPPQVKA
TIISEQQAKSLLKNENTRNECSGEILNNCCVMEYHQATGTLSAHFRNMSLKRIKRADRRG
AESVTEEKFTVLFESQFSVGSNELVFQVKTLSLPVVVIVHGSQDHNATATVLWDNAFAEP
GRVPFAVPDKVLWPQLCEALNMKFKAEVQSNRGLTKENLVFLAQKLFNSSSSHLEDYNGM
SVSWSQFNRENLPGWNYTFWQWFDGVMEVLKKHHKPHWNDGAILGFVNKQQAHDLLINKP
DGTFLLRFSDSEIGGITIAWKFDSPDRNLWNLKPFTTRDFSIRSLADRLGDLSYLIYVFP
DRPKDEVFSKYYTPVLAKAVDGYVKPQIKQVVPEFVSASADSAGGSATYMDQAPSPAVCP
QAHYNMYPQNPDPVLDQDGEFDLDETMDVARHVEELLRRPMDSLDPRLSPPTGLFTSARG
SLS
NT seq 2352 nt   +upstreamnt  +downstreamnt
atggcgggctggatccaagcccaacagctgcagggagatgcgcttcgccagatgcaggtg
ctgtatgggcagcacttccccatcgaggtccggcattacttagcgcagtggatcgagagc
cagccgtgggatgccatcgacctggacaatccccaggaccgaccccaggccacccagctc
ctggaggggctggtgcaggagctgcagaagaaggcagagcaccaagtgggggaagatggg
ttcttactgaagatcaagctggggcactacgccacgcagctccagaacacgtatgaccgt
tgccccatggaattggtgcgctgcatccgccatattctgtacaatgaacaaaggctggtc
cgagaagccaacaatggtagttcttcttctgggatcctggttgatgccatgtcccagaaa
caccttcagatcaaccagacacttgaggagctgcgactggtcacacaggacacagagaat
gagctgaagaagctgcagcagactcaagagtacttcatcatccaatatcaagagagcctg
aggatccaggctcagttttcccagctggcccagctgaacccccaggagcgtctgagccgg
gagacggccctccagcagaagcaggtgtccctggaggcctggctgcagcgcgaggcccag
acgctgcagcagtaccgcgtggagctggccgagaagcaccagaagaccctgcagctgctg
cggaagcagcagaccatcattctggatgacgagctgatccagtggaagcggcggcagcag
ctggcggggaacggagggccccccgagggcagcctggacgtgctacaatcctggtcttat
ttcaccagtggtctggttcctgctgcaggctttggtgcccccgtcctgtgccaccttccc
cgggaggggcgtccctgggtgagggagtgcgatacttacctaaatatttcatcacgggag
gaaatcatcgagaagcagccccctcaggtcctgaagacccagaccaagttcgcagccacc
gtgcgcctgctggtgggcgggaagctgaacgtgcacatgaaccccccccaggtgaaggcc
accatcatcagtgagcagcaggccaagtcgctgctcaagaacgagaacacccgcaatgag
tgcagcggggagatcttgaacaactgttgtgtgatggagtatcaccaggccacaggcacc
ctcagcgctcacttcaggaacatgtcgctaaagaggatcaagcgcgctgaccggcgaggc
gcagagtccgtgacggaggagaagttcacggtcctgtttgagtctcagttcagcgttggc
agcaatgagcttgtgttccaggtgaagaccctctcccttcctgtggttgtcatcgttcac
ggcagccaggaccacaatgctactgccaccgtgctatgggacaatgcctttgctgagccg
ggcagggtgccgtttgcggtgcctgacaaagtcctgtggccgcagctgtgcgaggcgctc
aacatgaaattcaaggccgaagtgcagagcaaccggggcctgaccaaggagaacctcgtg
ttcctggcgcagaagctgttcaacagcagtagcagccacctcgaggactacaacggcatg
tccgtgtcctggtcccagttcaacagggagaacttgccaggctggaactacaccttctgg
cagtggttcgatggggtcatggaggtgctgaagaaacatcacaagccccattggaatgac
ggggccatcctaggttttgtgaataagcaacaggcccacgacctgctcatcaacaagccc
gacggcaccttcctgttgcgctttagcgactcagaaatagggggcatcaccatcgcctgg
aagtttgactctcctgaccgtaacctgtggaatctgaagccgttcaccacgcgggatttc
tccatccggtccctggccgaccggctgggggacctgagctatctcatctacgtgtttccc
gaccggcccaaggatgaggtcttctccaagtactatactcctgtgctcgctaaagcagtg
gacggatacgtgaagccacagatcaagcaagtggtccctgagtttgtgagcgcctctgcg
gactctgccgggggcagcgccacctacatggaccaggccccctccccagccgtgtgcccc
caggctcattataacatgtacccacagaaccccgaccccgtcctcgaccaggatggagaa
ttcgacctggatgagaccatggatgtggcccggcacgtggaggaactcttacgccgccct
atggacagtctggacccccgcctctccccgcctactggtctcttcacctctgccagaggc
tcgctctcgtga

KEGG   Physeter catodon (sperm whale): 102994339
Entry
102994339         CDS       T06011                                 

Gene name
STAT5B
Definition
(RefSeq) signal transducer and activator of transcription 5B
  KO
K11224  signal transducer and activator of transcription 5B
Organism
pcad  Physeter catodon (sperm whale)
Pathway
pcad04012  ErbB signaling pathway
pcad04062  Chemokine signaling pathway
pcad04217  Necroptosis
pcad04630  JAK-STAT signaling pathway
pcad04658  Th1 and Th2 cell differentiation
pcad04659  Th17 cell differentiation
pcad04917  Prolactin signaling pathway
pcad04933  AGE-RAGE signaling pathway in diabetic complications
pcad04935  Growth hormone synthesis, secretion and action
pcad05161  Hepatitis B
pcad05162  Measles
pcad05166  Human T-cell leukemia virus 1 infection
pcad05200  Pathways in cancer
pcad05203  Viral carcinogenesis
pcad05220  Chronic myeloid leukemia
pcad05221  Acute myeloid leukemia
pcad05223  Non-small cell lung cancer
Brite
KEGG Orthology (KO) [BR:pcad00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04012 ErbB signaling pathway
    102994339 (STAT5B)
   04630 JAK-STAT signaling pathway
    102994339 (STAT5B)
 09140 Cellular Processes
  09143 Cell growth and death
   04217 Necroptosis
    102994339 (STAT5B)
 09150 Organismal Systems
  09151 Immune system
   04658 Th1 and Th2 cell differentiation
    102994339 (STAT5B)
   04659 Th17 cell differentiation
    102994339 (STAT5B)
   04062 Chemokine signaling pathway
    102994339 (STAT5B)
  09152 Endocrine system
   04917 Prolactin signaling pathway
    102994339 (STAT5B)
   04935 Growth hormone synthesis, secretion and action
    102994339 (STAT5B)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    102994339 (STAT5B)
   05203 Viral carcinogenesis
    102994339 (STAT5B)
  09162 Cancer: specific types
   05221 Acute myeloid leukemia
    102994339 (STAT5B)
   05220 Chronic myeloid leukemia
    102994339 (STAT5B)
   05223 Non-small cell lung cancer
    102994339 (STAT5B)
  09167 Endocrine and metabolic disease
   04933 AGE-RAGE signaling pathway in diabetic complications
    102994339 (STAT5B)
  09172 Infectious disease: viral
   05166 Human T-cell leukemia virus 1 infection
    102994339 (STAT5B)
   05161 Hepatitis B
    102994339 (STAT5B)
   05162 Measles
    102994339 (STAT5B)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03000 Transcription factors [BR:pcad03000]
    102994339 (STAT5B)
Transcription factors [BR:pcad03000]
 Eukaryotic type
  beta-Scaffold factors with minor groove contacts
   STAT
    102994339 (STAT5B)
SSDB
Motif
Pfam: STAT_bind STAT_alpha STAT_int SH2
Other DBs
NCBI-GeneID: 102994339
NCBI-ProteinID: XP_023985796
UniProt: A0A2Y9T635
LinkDB
Position
14
AA seq 787 aa
MAVWIQAQQLQGDALHQMQALYGQHFPIEVRHYLSQWIESQAWDSIDLDNPQENIKATQL
LEGLVQELQKKAEHQVGEDGFLLKIKLGHYATQLQNTYDRCPMELVRCIRHILYNEQRLV
REANNGNSPAGSLADAMSQKHLQINQTFEELRLVTQDTENELKKLQQTQEYFIIQYQESL
RIQAQFSQLAQLNPQERLSRETALQQKQVSLEAWLQREAQTLQQYRVELAEKHQKTLQLL
RKQQTIILDDELIQWKRRQQLAGNGGPPEGSLDVLQSWCEKLAEIIWQNRQQIRRAEHLC
QQLPIPGPVEEMLAEVNATITDIISALVTSTFIIEKQPPQVLKTQTKFAATVRLLVGGKL
NVHMNPPQVKATIISEQQAKSLLKNENTRNDYSGEILNNCCVMEYHQATGTLSAHFRNMS
LKRIKRSDRRGAESVTEEKFTILFESQFSVGGNELVFQVKTLSLPVVVIVHGSQDNNATA
TVLWDNAFAEPGRVPFAVPDKVLWPQLCEALNMKFKAEVQSNRGLTKENLVFLAQKLFNS
SSSHLEDYNGMSVSWSQFNRENLPGRNYTFWQWFDGVMEVLKKHLKPHWNDGAILGFVNK
QQAHDLLINKPDGTFLLRFSDSEIGGITIAWKFDSQERMFWNLMPFTTRDFSIRSLADRL
GDLSYLIYVFPDRPKDEVYSKYYTPVPCEPATAKAVDGYVKPQIKQVVPEFVSASADSAG
GSATYMDQAPSPAVCPQAHYNMYPQNPDPVIDNDGDFDLDDTMDVARRVEELLGRPMDSQ
WIPHAQS
NT seq 2364 nt   +upstreamnt  +downstreamnt
atggctgtgtggatacaagcccagcagctccaaggagatgctcttcatcagatgcaagca
ttgtatggtcagcatttccccattgaggtgcggcattacttatcccagtggattgaaagc
caagcttgggactcaatagatcttgataatccacaggagaacattaaggccacccagctc
ctggaggggctggtgcaggagctgcagaagaaggcagagcaccaagtgggggaagatggg
ttcttactgaagatcaagctggggcactacgccacgcagctccagaacacgtatgatcgc
tgccccatggagctggtccgctgcatccgccatattctgtacaatgaacagaggctggtc
cgagaagccaacaatggtaattctccggctggaagtctcgccgatgccatgtcccagaaa
caccttcagatcaaccagacatttgaggagctgcgactggtcactcaagacacagagaat
gagctgaagaagctgcagcagactcaagagtacttcatcatccaatatcaagagagcctg
aggatccaggctcagttttcccagctggcccagctgaacccccaggagcgtctgagccgg
gagacggccctccagcagaagcaggtgtccctggaggcctggctgcagcgcgaggcccag
acgctgcagcagtaccgcgtggagctggccgagaagcaccagaagaccctgcagctgctg
cggaagcagcagaccatcattctggatgacgagctgatccagtggaagcggcggcagcag
ctggcggggaacggagggccccccgagggcagcctggacgtgctacaatcctggtgtgag
aagttggcggagatcatctggcagaaccgacagcagatccgcagagctgagcacctctgc
cagcagctgcccatccccggccccgtggaggagatgctggctgaggtcaacgccaccatc
acagacatcatctcagccctggtgaccagcacgttcatcatcgagaagcagccccctcag
gtcctgaagacccagaccaagttcgcagccaccgtgcgcctgctggtgggcgggaagctg
aacgtgcacatgaaccccccccaggtgaaggccaccatcatcagtgagcagcaggccaag
tcgctgctcaagaacgagaacacccgcaatgattacagcggggagatcttgaacaactgc
tgtgtgatggagtatcaccaggccacgggcaccctcagcgctcacttcaggaacatgtcc
ctgaaacgaattaagaggtctgaccgtcgtggagcggagtcggtgacagaagaaaaattt
acaatcctgtttgaatcacagttcagtgttggtggaaatgagctggtttttcaagtcaag
accctgtccctcccggtggtggtgattgttcatggcagccaggacaacaatgcgacggcc
actgttctctgggacaacgcttttgcagagcctggcagggtgccgtttgcggtgcctgac
aaagtcctgtggccgcagctgtgcgaggcgctcaacatgaaattcaaggccgaagtgcag
agcaaccggggcctgaccaaggagaacctcgtgttcctggcgcagaagctgttcaacagc
agtagcagccacctcgaggactacaacggcatgtccgtgtcctggtcccagttcaacagg
gagaatttaccaggacggaattacactttctggcagtggttcgacggtgtgatggaagtg
ttaaaaaaacatctcaagcctcattggaatgatggggctatcttgggtttcgtgaacaag
caacaggcccacgacctactcattaacaagcctgacgggaccttcctgctgaggttcagt
gactctgaaattggtggcatcaccattgcttggaagtttgattctcaggaaagaatgttt
tggaatctgatgccttttaccaccagagacttctccatccggtccctggctgaccgcttg
ggagacctgagttaccttatctacgtgtttcctgaccggccaaaagatgaagtgtactcc
aaatattacaccccagttccctgcgagcctgccactgctaaagcagtggacggatacgtg
aagccacagatcaagcaagtggtccctgagtttgtgagcgcctctgcggactctgccggg
ggcagcgccacctacatggaccaggccccctccccagccgtgtgcccccaggctcattat
aacatgtacccacagaaccctgaccccgtcatcgacaacgatggggacttcgatctggac
gacacgatggacgtggcgcggcgcgtggaggagctcttaggccggcctatggacagtcag
tggatcccccatgcgcagtcgtga

DBGET integrated database retrieval system