KEGG   Physeter catodon (sperm whale): 102976778
Entry
102976778         CDS       T06011                                 

Gene name
ELK1
Definition
(RefSeq) ETS domain-containing protein Elk-1
  KO
K04375  ETS domain-containing protein Elk-1
Organism
pcad  Physeter catodon (sperm whale)
Pathway
pcad04010  MAPK signaling pathway
pcad04012  ErbB signaling pathway
pcad04014  Ras signaling pathway
pcad04510  Focal adhesion
pcad04910  Insulin signaling pathway
pcad04912  GnRH signaling pathway
pcad04921  Oxytocin signaling pathway
pcad05140  Leishmaniasis
pcad05161  Hepatitis B
pcad05163  Human cytomegalovirus infection
pcad05166  Human T-cell leukemia virus 1 infection
pcad05200  Pathways in cancer
pcad05205  Proteoglycans in cancer
pcad05213  Endometrial cancer
pcad05225  Hepatocellular carcinoma
Brite
KEGG Orthology (KO) [BR:pcad00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04010 MAPK signaling pathway
    102976778 (ELK1)
   04012 ErbB signaling pathway
    102976778 (ELK1)
   04014 Ras signaling pathway
    102976778 (ELK1)
 09140 Cellular Processes
  09144 Cellular community - eukaryotes
   04510 Focal adhesion
    102976778 (ELK1)
 09150 Organismal Systems
  09152 Endocrine system
   04910 Insulin signaling pathway
    102976778 (ELK1)
   04912 GnRH signaling pathway
    102976778 (ELK1)
   04921 Oxytocin signaling pathway
    102976778 (ELK1)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    102976778 (ELK1)
   05205 Proteoglycans in cancer
    102976778 (ELK1)
  09162 Cancer: specific types
   05225 Hepatocellular carcinoma
    102976778 (ELK1)
   05213 Endometrial cancer
    102976778 (ELK1)
  09172 Infectious disease: viral
   05166 Human T-cell leukemia virus 1 infection
    102976778 (ELK1)
   05161 Hepatitis B
    102976778 (ELK1)
   05163 Human cytomegalovirus infection
    102976778 (ELK1)
  09174 Infectious disease: parasitic
   05140 Leishmaniasis
    102976778 (ELK1)
Transcription factors [BR:pcad03000]
 Eukaryotic type
  Helix-turn-helix
   Tryptophan clusters Ets-type
    102976778 (ELK1)
SSDB
Motif
Pfam: Ets
Other DBs
NCBI-GeneID: 102976778
NCBI-ProteinID: XP_007104254
UniProt: A0A2Y9EL15
LinkDB
Position
Unknown
AA seq 442 aa
MDPSVTLWQFLLQLLREQGNGHIISWTSRDGGEFKLVDAEEVARLWGLRKNKTNMNYDKL
SRALRYYYDKNIIRKVSGQKFVYKFVSYPEVAGCSTEDCPPQPEVSVTSTVANVGTTAVH
AIPGDTASGKPGTPRGAGVAGPGGLARSSRNDYMRSGLYSTFTIQSLQPQPQPPSHPRPS
TVLPNTAHAGAAVPPSGSGSTSPSPLEACLEAEEAGLPLQVILTPPEAPNLKSEEPNMEP
GLGRPLPPEVKVEEPKEELEASATGEAGFVLEAVKAEPFEPKAEPEAPPAEGVPARLPAV
VMDTAAPVGGLAASTTSSTEIAQPQKGRKPRDLELPLSPSLLGGPGPERTPGSGTGSGLQ
APGPALTPSLLPTHTLTPVLLTPSSLPPSIHFWSTLSPIAPRSPAKLSFQFPSSGSAQVH
IPSISVDGLSTPVVLSPGPQKP
NT seq 1329 nt   +upstreamnt  +downstreamnt
atggacccttctgtgacgctgtggcagtttctgctgcagctgttgagagagcaaggcaat
ggccacatcatctcctggacctcccgggatggcggtgagttcaagctggtggatgctgag
gaggtggcccggctctgggggctgcgcaagaataagaccaacatgaattatgacaagctc
agccgggccttgcggtactactatgataagaacatcatccgcaaagtgagtggccagaag
ttcgtctacaagtttgtgtcctaccccgaggtcgcggggtgctccactgaggactgccca
ccccagcctgaggtgtctgtcacctccactgtggcaaatgtgggcaccacagctgtacac
gccatccccggggacactgcctctgggaaaccaggcacacccaggggtgcaggagtggca
ggcccgggcggcttggcgcgcagcagccggaacgattacatgcgctcgggcctctattcc
accttcaccatccagtccctgcagccgcagccacagccgccctctcatcctcggccttcc
acagtgctccccaacaccgcccatgcaggagcagcagtgcccccctcggggagcgggagc
accagcccaagccccttggaggcctgcctggaggctgaggaggctggcctgcctctgcag
gtcatcctgaccccacccgaggccccaaaccttaaatccgaagagccaaatatggagcct
gggttgggccggccactgcccccagaagtcaaagtggaagagcccaaggaagagttagaa
gcctctgccactggggaggcggggtttgtcctggaagccgtcaaggccgagccctttgag
cccaaggccgagccagaagcccctcccgcggagggcgtgccagcccggctgcccgctgtc
gttatggacactgcggcgccggtgggcggccttgcggcttccacaacctccagcacggag
atcgcccagcctcagaagggccggaagccccgggacctggagcttccactcagcccgagc
ttgctgggtgggccgggacccgaacggactccgggatcgggaactggttccggtctgcag
gcgccaggcccagcgctgacgccttccctgctacctacgcacacattgaccccggtgctg
ctgacacccagctcgctgccccccagcattcacttctggagcaccctgagtcccattgca
ccccgtagcccagccaagctctccttccagtttccgtccagtggcagcgcccaggtgcac
atcccttccatcagcgtggatggcctctcaacccccgtggtgctctccccagggccccag
aagccatga

DBGET integrated database retrieval system