KEGG   Physeter catodon (sperm whale): 102976793
Entry
102976793         CDS       T06011                                 

Gene name
ITGB7
Definition
(RefSeq) integrin beta-7
  KO
K06590  integrin beta 7
Organism
pcad  Physeter catodon (sperm whale)
Pathway
pcad04151  PI3K-Akt signaling pathway
pcad04510  Focal adhesion
pcad04512  ECM-receptor interaction
pcad04514  Cell adhesion molecules
pcad04672  Intestinal immune network for IgA production
pcad04810  Regulation of actin cytoskeleton
pcad05165  Human papillomavirus infection
pcad05202  Transcriptional misregulation in cancer
pcad05410  Hypertrophic cardiomyopathy
pcad05412  Arrhythmogenic right ventricular cardiomyopathy
pcad05414  Dilated cardiomyopathy
Brite
KEGG Orthology (KO) [BR:pcad00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04151 PI3K-Akt signaling pathway
    102976793 (ITGB7)
  09133 Signaling molecules and interaction
   04512 ECM-receptor interaction
    102976793 (ITGB7)
   04514 Cell adhesion molecules
    102976793 (ITGB7)
 09140 Cellular Processes
  09144 Cellular community - eukaryotes
   04510 Focal adhesion
    102976793 (ITGB7)
  09142 Cell motility
   04810 Regulation of actin cytoskeleton
    102976793 (ITGB7)
 09150 Organismal Systems
  09151 Immune system
   04672 Intestinal immune network for IgA production
    102976793 (ITGB7)
 09160 Human Diseases
  09161 Cancer: overview
   05202 Transcriptional misregulation in cancer
    102976793 (ITGB7)
  09166 Cardiovascular disease
   05410 Hypertrophic cardiomyopathy
    102976793 (ITGB7)
   05412 Arrhythmogenic right ventricular cardiomyopathy
    102976793 (ITGB7)
   05414 Dilated cardiomyopathy
    102976793 (ITGB7)
  09172 Infectious disease: viral
   05165 Human papillomavirus infection
    102976793 (ITGB7)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:pcad04147]
    102976793 (ITGB7)
   04515 Cell adhesion molecules [BR:pcad04515]
    102976793 (ITGB7)
Exosome [BR:pcad04147]
 Exosomal proteins
  Exosomal proteins of haemopoietic cells  (B-cell, T-cell, DC-cell, reticulocyte, and mast cell)
   102976793 (ITGB7)
Cell adhesion molecules [BR:pcad04515]
 Integrins
  Integrin beta subunits
   102976793 (ITGB7)
SSDB
Motif
Pfam: Integrin_beta Integrin_b_cyt PSI_integrin EGF_2 I-EGF_1
Other DBs
NCBI-GeneID: 102976793
NCBI-ProteinID: XP_007125838
UniProt: A0A2Y9FKX8
LinkDB
Position
6
AA seq 800 aa
MVALSMVLVFLLALSRGESELDTKISSPQETTEWGDPGLSLPGSCKPAPSCQKCILSHPS
CAWCKQLNFTASGEAEVRRCALREELLARGCPPGELEEPRGRQEVLQDEPLSQGTRGEGA
TQLAPQRVRVTLRPGEPQQLQVRFLRAEGYPVDLYYLMDLSYSMKDDLERVRQLGHALLV
RLQEVTHSVRIGFGSFVDKMVLPFVSTVPSKLRHPCPTRLERCQPPFSFHHVLPLTGDAK
AFEREVGRQSVSGNLDSPEGGFDAILQAALCQEQIGWRNVSRLLVFTSDDTFHTAGDGKL
GGIFMPSDGHCHLDSNGLYSRSPEFDYPSVGQVAQALSAANIQPIFAVTGATLPVYQELS
KLIPKSAVGELSEDSSNVVQLIMDAYNSLSSTVTLEHERSLLPPGVHISYDSQCGGPEKR
QDEAGDRGQCNHVRINQTVNFLVTLQATHCLPEPHLLRFRARGFSEELTVELQTLCDCNC
SDTQLQAPHCSDGQGHLQCGVCSCVPGHLGRLCECSEAELSSLDLESGCRAPNGTGPLCS
GRGWCQCGRCTCSGHSSGRLCECDDASCERHEGILCGGFGRCQCGVCHCHANRTGRACEC
SGDTDNCVSPEGGLCNGHGYCNCNRCQCLDGYYGALCDQCSGCKTPCERHRDCAECGAFG
TGPLAMNCSLACAHANVTLALTPILDDGWCKERTHDNQLFFFLAEDEAGGRVMLRVRPLE
KGSDHTQIIVLGCVGGIVVVGLGLVLAYRLSVEIYDRREYSRFEKEQQQLKWKQDNNPLY
KSAITTTVNPCFQEAESAPL
NT seq 2403 nt   +upstreamnt  +downstreamnt
atggtggctttgtcaatggtccttgttttcctgctggccctgagcagaggtgaaagtgaa
ctggacaccaagatctcatccccacaggagaccaccgaatggggggatcctgggctgtcc
ctaccagggtcctgcaagccagctccctcctgtcaaaagtgcatcctctcacacccgagc
tgtgcatggtgcaagcaactgaacttcacggcgtccggagaggcagaggtgcggcgctgc
gccctgcgagaggagctgctggcccggggctgtcccccgggggagctggaggagccccgc
ggccggcaggaggtgctgcaggacgagccgctcagccagggcacccgcggcgagggggcc
acccagctggcaccgcagcgggtccgggtcacgctgcggccgggagagccccagcagctc
caggtccgcttccttcgagccgagggataccctgtggacctgtactaccttatggacctg
agctactccatgaaggacgacctggagcgcgtgcgccagcttgggcacgcgctgctggtg
aggttgcaggaagtcacccactccgtgcgcattggctttggttccttcgtggacaaaatg
gtgctgcccttcgtgagcacagtgccctccaagcttcgccacccctgccccacccggctg
gagcgctgccagccgcccttcagctttcaccatgtgctacccctcaccggggatgctaag
gccttcgaacgggaggtgggacgccagagcgtgtccggcaacctggactcgcctgaaggt
ggctttgatgccattctgcaggctgccctgtgccaggagcagattggctggagaaatgtg
tcccggctactggtgttcacttcagatgacacattccacacagctggggatggcaagttg
ggtggcattttcatgcccagcgacgggcactgccacttggacagcaatggcctctacagt
cgcagcccagagtttgactacccctccgtgggtcaggtagcccaggccctctctgcggca
aacatccagcccatctttgctgtcaccggtgccacactgcctgtctaccaggagctgagt
aagctgattcccaagtccgcagtgggggagctgagtgaggactccagcaatgtggtacag
ctcatcatggatgcttataatagcctatcatccactgtgacccttgaacatgaacgctct
ctactccctcctggggtccacatctcttacgattctcagtgtgggggtcctgagaagaga
caggatgaggctggtgacaggggccagtgcaaccacgtccgaatcaaccagacagtgaat
tttttggttactctccaagctacccactgcctcccagagccccatctgctgaggttccga
gcccgtggcttctcagaggagctgactgtggagttgcaaacactgtgtgactgtaactgc
agtgacacccagctccaggctcctcactgcagtgacggccaggggcacctacaatgcggg
gtgtgcagctgtgtccctggccacctgggtcgactctgtgagtgctctgaggctgagctg
tcctccctggatctggaatctgggtgccgagcccccaatggcacagggcccctgtgcagt
gggaggggatggtgccagtgtggacgctgcacctgcagcggacatagctctggacgtctg
tgcgaatgtgatgatgccagctgtgagcgacatgagggaatcctctgtggaggctttggc
cgctgccaatgtggagtgtgtcactgtcatgccaatcgcacgggcagagcatgcgaatgc
agcggggacacagacaactgtgtcagtcccgagggagggctgtgcaatgggcatggatac
tgcaactgcaaccgctgccagtgcttggacggctattacggtgccctatgtgatcagtgc
tcaggctgcaagacaccatgcgagagacacagggactgcgcagagtgtggcgcctttggg
actggtcctctggccatgaattgcagcctggcatgtgcccatgccaacgtgactctggct
ttgacccctatcctggatgatggctggtgcaaagagaggacccacgacaaccagctcttc
ttcttcctggcagaggatgaagccggaggcagggtcatgctgagagtgagacccctggaa
aaggggtcagaccacacccaaatcatcgtgctgggctgtgtggggggcatcgtggtagtg
ggactgggattggtcctggcttaccggctctcagtggaaatctatgaccgccgagaatac
agtcgttttgaaaaggagcagcagcagctcaagtggaagcaggacaacaatcctctctac
aagagcgccatcacgaccactgtcaacccctgctttcaagaggcagaaagcgcccctctc
tga

KEGG   Physeter catodon (sperm whale): 102982672
Entry
102982672         CDS       T06011                                 

Gene name
ITGB8
Definition
(RefSeq) integrin beta-8 isoform X1
  KO
K06591  integrin beta 8
Organism
pcad  Physeter catodon (sperm whale)
Pathway
pcad04151  PI3K-Akt signaling pathway
pcad04510  Focal adhesion
pcad04512  ECM-receptor interaction
pcad04514  Cell adhesion molecules
pcad04810  Regulation of actin cytoskeleton
pcad05165  Human papillomavirus infection
pcad05410  Hypertrophic cardiomyopathy
pcad05412  Arrhythmogenic right ventricular cardiomyopathy
pcad05414  Dilated cardiomyopathy
Brite
KEGG Orthology (KO) [BR:pcad00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04151 PI3K-Akt signaling pathway
    102982672 (ITGB8)
  09133 Signaling molecules and interaction
   04512 ECM-receptor interaction
    102982672 (ITGB8)
   04514 Cell adhesion molecules
    102982672 (ITGB8)
 09140 Cellular Processes
  09144 Cellular community - eukaryotes
   04510 Focal adhesion
    102982672 (ITGB8)
  09142 Cell motility
   04810 Regulation of actin cytoskeleton
    102982672 (ITGB8)
 09160 Human Diseases
  09166 Cardiovascular disease
   05410 Hypertrophic cardiomyopathy
    102982672 (ITGB8)
   05412 Arrhythmogenic right ventricular cardiomyopathy
    102982672 (ITGB8)
   05414 Dilated cardiomyopathy
    102982672 (ITGB8)
  09172 Infectious disease: viral
   05165 Human papillomavirus infection
    102982672 (ITGB8)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:pcad04147]
    102982672 (ITGB8)
   04515 Cell adhesion molecules [BR:pcad04515]
    102982672 (ITGB8)
Exosome [BR:pcad04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   102982672 (ITGB8)
Cell adhesion molecules [BR:pcad04515]
 Integrins
  Integrin beta subunits
   102982672 (ITGB8)
SSDB
Motif
Pfam: Integrin_beta PSI_integrin EGF_2 I-EGF_1 Sigma_reg_N EGF_Tenascin
Other DBs
NCBI-GeneID: 102982672
NCBI-ProteinID: XP_023984857
UniProt: A0A2Y9T5H5
LinkDB
Position
5
AA seq 767 aa
MCRSALAFFTATLVCLQNCRPGPAPFLRAAWVFSVVLGLGQSEDNRCASSNAVSCTKCLA
LGPECGWCAQEDFISGGSKNERCDIVSNLINKGCSIDLIEYPSVHVTPSENEINTQVTPG
EVLIQLRQGAEANFMLKIHPLKKYPVDLYYLVDVSASMHNNIEKLNSVGNDLSRKMAFFS
HDFRLGFGSYVDKTVSPYISIHPERIHNQCSDYNLDCMPPHGYIHVLSLTENITEFEKAV
HRQKISGNIDTPEGGFDAMLQAAVCESHIGWRKEAKRLLLVMTDQTSHLALDSKLAGIVV
PNDGNCHLKNNVYVRSTSMEHPSLGQLSEKLIDNNINVIFAVQGKQFHWYKDLLPLLPGT
IAGEIESKAANLNNLVVEAYQKLISEVKVQVENQIKGIYFNITAICPDGSRKPGTDGCGN
VTSNDEVLFNVTVTMEKCDVMEGKSYAIIKPIGFNETTKIRIHRNCSCQCDDSRGPKRKC
VEETFLDAKCFQCDENKCHFDEDQFPSESCKSHKDQPACSGRGVCICGKCLCHKIKLGKV
YGKYCEKDDFSCPYHHGNLCAGHGECEAGKCQCFRGWEGDRCQCASASAQHCVNPKGQVC
SGRGTCVCGMCECTDPRSIGRFCEHCPTCHTACNENWNCVQCLHPHNLSQAILDRCKTSC
TLKEQHYVDQTSECFSSPSYLRIFFIIFIVTFLIGLLKVLIIRQVILQWNSNKIKSSADY
RVSASKKDKLILQGVCTRAVTYRREKPEEIKMDISKLNTHETFRCNF
NT seq 2304 nt   +upstreamnt  +downstreamnt
atgtgccgctcggccctggctttttttactgccacattagtctgcctgcaaaactgcagg
ccaggtcctgccccattcctccgggcggcctgggtgttttcagttgttcttggactgggc
caaagtgaagacaatagatgtgcatcttcgaatgcagtgtcctgcaccaagtgccttgcg
ctgggtccggaatgtggatggtgtgctcaagaggatttcatttcaggtggatcaaagaat
gaacgttgtgatattgtttccaatttaataaacaaaggctgctcaattgatttgatagaa
tacccatctgtgcatgtaacaccaagtgaaaatgaaatcaatacccaggtgacaccagga
gaagtgctgattcagctacgtcaaggagctgaagctaattttatgctgaaaattcatcct
ctgaagaaataccctgtggatctttattatctggttgatgtctcagcatcaatgcacaat
aatattgaaaaattaaattctgttggaaatgatttatctagaaaaatggcatttttctcc
catgacttccgccttggatttggctcatatgttgataaaacagtttcaccatacattagt
atccatccagaaagaattcataatcaatgcagtgactacaacttagactgtatgcctccc
catgggtatatccatgtgctgtctttgacggagaacatcactgagtttgaaaaagcagtt
cacagacagaagatctctggaaatatagatacacctgaaggaggttttgatgctatgctt
caggcagctgtctgtgagagtcacattggatggcgaaaagaagctaaaagattgctgctg
gtgatgacagatcagacatctcatcttgccctagacagcaaattggcaggcatagtggtg
ccaaatgacggaaactgccatctgaaaaacaacgtctacgtcagatcaacgagcatggaa
catccctcactaggccaactttcagaaaagttaatagacaacaacattaatgtcatattt
gcagttcaaggaaaacagtttcactggtataaggatcttctacccctcttgcctggcacc
attgctggtgaaatagaatcaaaggctgcaaacctcaataatctggttgtagaagcctat
cagaaactcatttcagaagtgaaagttcaggtggaaaaccagataaaaggcatctatttt
aacattactgccatctgtccagatggaagcagaaagccaggcacagatggatgtggaaat
gtgacaagcaatgacgaagttcttttcaatgtaacagttacaatggaaaaatgtgatgtc
atggaaggaaagagctatgcaataatcaaacctattggtttcaatgaaaccactaaaatt
cgtatacatagaaactgcagctgtcagtgtgatgacagcagaggacctaaaagaaagtgt
gtagaagaaacttttctagatgccaagtgcttccagtgtgatgaaaataaatgtcatttt
gatgaagatcaatttccttctgaaagttgcaagtcacacaaggatcaacctgcttgcagc
ggtagaggagtttgtatttgtgggaaatgtttatgtcacaaaattaagcttggaaaagtg
tatggaaaatactgtgaaaaagatgacttttcttgtccatatcaccatggaaatctgtgt
gctgggcatggagagtgtgaggcaggcaaatgccagtgcttcaggggctgggaaggggat
cggtgccagtgcgcatcagcatctgcccagcactgtgtcaatccgaaaggccaagtgtgt
agtggaagaggcacatgtgtatgtggcatgtgtgagtgcaccgatcccaggagcatcggc
cgcttctgtgaacattgtcccacatgtcacacagcctgcaatgaaaactggaattgtgtg
caatgccttcaccctcacaatctgtctcaagctatacttgatcggtgtaaaacctcatgt
actctcaaggaacagcattatgtggaccaaacatcagaatgtttctctagcccaagctat
ttgaggatatttttcatcatcttcatagttacattcttgatcgggttgcttaaagtcctt
attattagacaggtgatactacaatggaatagtaataaaattaagtcctcggcagattac
agggtgtcagcctcaaaaaaggacaagttgattctgcaaggcgtttgcacaagagcagta
acctaccgacgtgagaaacctgaagaaataaaaatggacattagcaaattaaacactcat
gaaactttcaggtgcaacttctaa

KEGG   Physeter catodon (sperm whale): 102984702
Entry
102984702         CDS       T06011                                 

Gene name
ITGB1
Definition
(RefSeq) integrin beta-1 isoform X2
  KO
K05719  integrin beta 1
Organism
pcad  Physeter catodon (sperm whale)
Pathway
pcad04015  Rap1 signaling pathway
pcad04145  Phagosome
pcad04151  PI3K-Akt signaling pathway
pcad04360  Axon guidance
pcad04510  Focal adhesion
pcad04512  ECM-receptor interaction
pcad04514  Cell adhesion molecules
pcad04530  Tight junction
pcad04611  Platelet activation
pcad04670  Leukocyte transendothelial migration
pcad04810  Regulation of actin cytoskeleton
pcad05100  Bacterial invasion of epithelial cells
pcad05133  Pertussis
pcad05135  Yersinia infection
pcad05140  Leishmaniasis
pcad05145  Toxoplasmosis
pcad05165  Human papillomavirus infection
pcad05200  Pathways in cancer
pcad05205  Proteoglycans in cancer
pcad05222  Small cell lung cancer
pcad05410  Hypertrophic cardiomyopathy
pcad05412  Arrhythmogenic right ventricular cardiomyopathy
pcad05414  Dilated cardiomyopathy
Brite
KEGG Orthology (KO) [BR:pcad00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04015 Rap1 signaling pathway
    102984702 (ITGB1)
   04151 PI3K-Akt signaling pathway
    102984702 (ITGB1)
  09133 Signaling molecules and interaction
   04512 ECM-receptor interaction
    102984702 (ITGB1)
   04514 Cell adhesion molecules
    102984702 (ITGB1)
 09140 Cellular Processes
  09141 Transport and catabolism
   04145 Phagosome
    102984702 (ITGB1)
  09144 Cellular community - eukaryotes
   04510 Focal adhesion
    102984702 (ITGB1)
   04530 Tight junction
    102984702 (ITGB1)
  09142 Cell motility
   04810 Regulation of actin cytoskeleton
    102984702 (ITGB1)
 09150 Organismal Systems
  09151 Immune system
   04611 Platelet activation
    102984702 (ITGB1)
   04670 Leukocyte transendothelial migration
    102984702 (ITGB1)
  09158 Development and regeneration
   04360 Axon guidance
    102984702 (ITGB1)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    102984702 (ITGB1)
   05205 Proteoglycans in cancer
    102984702 (ITGB1)
  09162 Cancer: specific types
   05222 Small cell lung cancer
    102984702 (ITGB1)
  09166 Cardiovascular disease
   05410 Hypertrophic cardiomyopathy
    102984702 (ITGB1)
   05412 Arrhythmogenic right ventricular cardiomyopathy
    102984702 (ITGB1)
   05414 Dilated cardiomyopathy
    102984702 (ITGB1)
  09171 Infectious disease: bacterial
   05135 Yersinia infection
    102984702 (ITGB1)
   05133 Pertussis
    102984702 (ITGB1)
   05100 Bacterial invasion of epithelial cells
    102984702 (ITGB1)
  09172 Infectious disease: viral
   05165 Human papillomavirus infection
    102984702 (ITGB1)
  09174 Infectious disease: parasitic
   05145 Toxoplasmosis
    102984702 (ITGB1)
   05140 Leishmaniasis
    102984702 (ITGB1)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04131 Membrane trafficking [BR:pcad04131]
    102984702 (ITGB1)
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:pcad04147]
    102984702 (ITGB1)
   04515 Cell adhesion molecules [BR:pcad04515]
    102984702 (ITGB1)
   04090 CD molecules [BR:pcad04090]
    102984702 (ITGB1)
Membrane trafficking [BR:pcad04131]
 Endocytosis
  Phagocytosis
   Integrins (complement receptors)
    102984702 (ITGB1)
Exosome [BR:pcad04147]
 Exosomal proteins
  Proteins found in most exosomes
   102984702 (ITGB1)
Cell adhesion molecules [BR:pcad04515]
 Integrins
  Integrin beta subunits
   102984702 (ITGB1)
CD molecules [BR:pcad04090]
 Proteins
  102984702 (ITGB1)
SSDB
Motif
Pfam: Integrin_beta Integrin_b_cyt Integrin_B_tail I-EGF_1 PSI_integrin EGF_2
Other DBs
NCBI-GeneID: 102984702
NCBI-ProteinID: XP_023985395
UniProt: A0A2Y9F676
LinkDB
Position
11
AA seq 798 aa
MNLQLIFWIGLISSVCYVFGQADENRCLKANAKSCGECIQAGPNCGWCTNSTFLQEGMPT
SARCDDLEALKKKGCHPDDIENPRGSKDIKKNKNVTNRSKGTAEKLQPEDITQIQPQQLV
LQLRSGEPQTFTLKFKRAEDYPIDLYYLMDLSYSMKDDLENVKSLGTDLMNEMRRITSDF
RIGFGSFVEKTVMPYISTTPAKLRNPCTSEQNCTSPFSYKNVLSLTDKGEVFNELVGKQR
ISGNLDSPEGGFDAIMQVAVCGSLIGWRNVTRLLVFSTDAGFHFAGDGKLGGIVLPNDGQ
CHLENDVYTMSHYYDYPSIAHLVQKLSENNIQTIFAVTEEFQPVYKELKNLIPKSAVGTL
SANSSNVIQLIIDAYNSLSSEVILENSKLPEGVTINYKSYCKNGVNGTGENGRKCSNISI
GDEVQFEISVTSNKCPNKNSETIKIKPLGFTEEVEIILQFICECECQSEGIPGSPKCHDG
NGTFECGACRCNEGRVGRHCECSTDEVNSEDMDAYCRKENSSEICSNNGECVCGQCVCRK
RDNTNEIYSGKFCECDNFNCDRSNGLICGGNGVCKCRVCECNPNYTGSACDCSLDTTSCT
AVNGQICNGRGVCECGACKCTDPKFQGPTCEMCQTCLGVCAEHKECVQCRAFNKGEKKDT
CAQECSHFNITKVENRDKLPQPGQVDPLSHCKEKDVDDCWFYFTYSVNGNNEATVHVVET
PECPTGPDIIPIVAGVVAGIVLIGLALLLIWKLLMIIHDRREFAKFEKEKMNAKWDTGEN
PIYKSAVTTVVNPKYEGK
NT seq 2397 nt   +upstreamnt  +downstreamnt
atgaatttacaactgattttctggattggattgatcagttcagtttgctatgtgtttggc
caagcagatgaaaatagatgtttaaaagcaaatgccaaatcatgtggagagtgtatacaa
gcagggccaaattgtggatggtgcacaaattccacatttttacaagaaggaatgcctact
tctgctcgatgtgatgatttagaggccttaaaaaagaagggctgtcatccagatgacatc
gaaaatcccagaggctccaaagatataaagaaaaataaaaatgtcaccaaccgtagcaaa
ggaacagcagagaaactgcagccagaagatattactcagatccaaccacagcagttggtt
ttgcaattacgatcaggggagccacagacatttacattaaaattcaagcgagctgaagac
tatcccatcgatctctactaccttatggacctctcctactctatgaaagacgacttggag
aatgtgaagagtcttggcactgatttgatgaatgaaatgaggaggattacttcagacttc
cgaattgggtttggctcatttgtggagaaaaccgtgatgccttacattagcacaacacca
gctaaactcaggaacccttgcacaagtgaacagaactgcaccagcccatttagctataaa
aatgtgctcagccttactgataaaggggaggtatttaatgaactggttggtaaacagcgc
atatctggaaatttggattctccagaaggtggctttgatgcaatcatgcaagttgcagtt
tgtggatcattgattggctggaggaatgtgacacggctgctggtgttttccacggatgct
gggtttcactttgccggagatgggaaacttggtggcattgttttaccaaatgatggacag
tgtcacctggaaaatgatgtgtacacaatgagccattattatgattatccttctattgct
caccttgtccagaaactaagcgaaaataacattcagacgatttttgcagttactgaagaa
tttcagcccgtttacaaggaactgaaaaatttgatccctaagtcagcagtaggaacatta
tctgcaaattccagcaatgtaattcagttgatcatcgatgcatacaattccctgtcttca
gaagtcattttggaaaacagcaaattaccagaaggagtaacaataaattacaagtcttac
tgcaagaatggggtgaatggaacaggggaaaatgggagaaaatgctctaatatttccatt
ggggatgaggttcaatttgaaatcagcgtaacttcaaataaatgtccaaataagaattct
gaaaccattaaaattaagcctctgggcttcactgaagaagtagagattattcttcagttc
atctgtgaatgtgaatgccagagtgaaggcatccctggcagtcccaagtgccatgatggc
aatgggacctttgagtgtggcgcgtgcaggtgcaatgagggccgtgttgggagacattgt
gaatgtagcacagatgaggtgaacagtgaagatatggacgcttactgcaggaaagaaaac
agttcagaaatatgtagcaacaacggagaatgtgtctgtggacagtgtgtgtgtcggaag
agggataatacaaacgaaatttattctggcaaattctgcgagtgtgataatttcaactgt
gatagatccaatggcttaatttgtggaggaaatggtgtctgcaagtgtcgtgtgtgtgaa
tgcaaccctaactacactggcagtgcctgtgactgttctctggacactacctcctgcacg
gctgtgaatgggcagatctgcaatggccggggcgtctgtgagtgtggcgcctgtaagtgt
acagatcccaagttccaagggccgacctgtgagatgtgccagacctgccttggagtctgt
gctgagcataaagaatgtgttcagtgccgagccttcaacaaaggagaaaagaaagacacg
tgcgcccaggaatgttcccatttcaacattaccaaggttgaaaatcgggacaaattgccc
cagccaggccaggttgatcccctgtcccattgtaaggagaaggacgttgacgattgctgg
ttctacttcacatattcagtgaacgggaacaatgaggccactgttcatgttgtagagact
ccagagtgccccactggtccagacattattccaattgtagcaggtgtggttgctggaatt
gttcttattggccttgcattgctgctgatttggaagcttttaatgatcattcatgacaga
agggaatttgccaaatttgaaaaggaaaaaatgaatgccaaatgggacacgggtgaaaat
cctatttataagagtgctgtgacaactgttgtcaatccgaagtatgagggaaaatga

KEGG   Physeter catodon (sperm whale): 102985278
Entry
102985278         CDS       T06011                                 

Gene name
ITGB4
Definition
(RefSeq) integrin beta-4 isoform X2
  KO
K06525  integrin beta 4
Organism
pcad  Physeter catodon (sperm whale)
Pathway
pcad04151  PI3K-Akt signaling pathway
pcad04510  Focal adhesion
pcad04512  ECM-receptor interaction
pcad04810  Regulation of actin cytoskeleton
pcad05165  Human papillomavirus infection
pcad05410  Hypertrophic cardiomyopathy
pcad05412  Arrhythmogenic right ventricular cardiomyopathy
pcad05414  Dilated cardiomyopathy
Brite
KEGG Orthology (KO) [BR:pcad00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04151 PI3K-Akt signaling pathway
    102985278 (ITGB4)
  09133 Signaling molecules and interaction
   04512 ECM-receptor interaction
    102985278 (ITGB4)
 09140 Cellular Processes
  09144 Cellular community - eukaryotes
   04510 Focal adhesion
    102985278 (ITGB4)
  09142 Cell motility
   04810 Regulation of actin cytoskeleton
    102985278 (ITGB4)
 09160 Human Diseases
  09166 Cardiovascular disease
   05410 Hypertrophic cardiomyopathy
    102985278 (ITGB4)
   05412 Arrhythmogenic right ventricular cardiomyopathy
    102985278 (ITGB4)
   05414 Dilated cardiomyopathy
    102985278 (ITGB4)
  09172 Infectious disease: viral
   05165 Human papillomavirus infection
    102985278 (ITGB4)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:pcad04147]
    102985278 (ITGB4)
   04515 Cell adhesion molecules [BR:pcad04515]
    102985278 (ITGB4)
   04090 CD molecules [BR:pcad04090]
    102985278 (ITGB4)
Exosome [BR:pcad04147]
 Exosomal proteins
  Exosomal proteins of colorectal cancer cells
   102985278 (ITGB4)
  Exosomal proteins of bladder cancer cells
   102985278 (ITGB4)
Cell adhesion molecules [BR:pcad04515]
 Integrins
  Integrin beta subunits
   102985278 (ITGB4)
CD molecules [BR:pcad04090]
 Proteins
  102985278 (ITGB4)
SSDB
Motif
Pfam: Integrin_beta fn3 Calx-beta Integrin_B_tail PSI_integrin I-EGF_1 Pur_ac_phosph_N EGF_2 SEA DUF3805
Other DBs
NCBI-GeneID: 102985278
NCBI-ProteinID: XP_007099813
UniProt: A0A2Y9EDM3
LinkDB
Position
14
AA seq 1755 aa
MAGPHPSWWTRLLLAALLSVSFPGDMANLCKKAQVKSCTECIRVDKDCAYCTDEMFKERR
CNTQAELLAAGCRQGSMVVMESSFEITEETQIDTTLRRSQVSPQGLRVRLRPGEERHFEL
QVFEPLESPMDLYILMDFSNSMSDDLDNLKKMGQDLAQVLNQLTSDYTIGFGKFVDKVSI
PQTDMRPEKLKEPWPNSEPPFSFKNVISLTEDVEEFRNKLKGERISGNLDAPEGGFDAIL
QTAVCTRDIGWRPDSTHLLVFSTESAFHYEADGANVLAGIMRRNDEECHLDATGTYTQYR
TQDYPSVPTLVRLLGQHNIIPIFAVTNYSYSYYEKLSSYFPVSSLGVLQEDSSNIVDLLQ
DAFNRIRSNLDIRALESPRGLRTEVTSRMFQKTNTGSFLIRRGEVGTYQVQLRAIEDLDG
THVCQLPEADRKGNIHLKPSFSNGLKMDVDIICDVCSCELQKQERSSHCSFNGDFMCGHC
VCNEGWSGKTCNCSTGSLSDLAPCHREGEDKLCSGQGECQCGHCVCYGEGRYEGEFCEYD
NFQCPRASGFLCNDRGRCSMGQCVCEPGWTGLSCDCPLSNATCIDSNGGICNGRGYCECG
RCHCNQQSLYTDTICEINYSAIRLGLCEDLRSCVQCQAWGTGEKKGHTCKECSFKVKMVD
ELKKAEEVVEYCSFRDEDDDCTYSYTVEGDGAPGPNSTVLVQRRKDCPPGSFWWLIPLLI
FLLLFLALLLPLCWKYCACCKACLALLPCCNRGHMVGFKEDHYMLRENLMASDHLDTPML
RSGNLKGRDMVRWKITNNVQRPGFASHAAGINPTELAPYGLSLRLARLCTENLLKPGTRE
CGQLRQEVEENLNEVYRHITGAQKLQQTKFRQQPNAGKKQDHTIVDTVLMAPRSAKQALL
KLTEKHVQQGAFHELKVAPGYYTLTADQDARGMVEFQEGVELVDVRVPLFIRPEDDDEKQ
LLVEAIDVPVGTATLGRRLVNVTILKEQASGIVSFEQPEYLVSRGEHVARIPIIRRILDN
GKSQVSYCTQDNTAQGNRDYIPTEGELLFQPGETWKELQVKVLELQEMDSLLRGCQTRRF
YIQLSNPKFGARLGQPQSATVIIGDRDELDGNLMGQTLSSLPLPRGDLGAPQNPNAKATG
SRKIHFNWLPPPGKPTGYRVKYWIQGDSESEAHLLDSKVPSVELTNLYPYCDYEMKVCAY
GAQGEGPYSSLVSCRTHPEVPSEPGRLAFNVVSSTVTQLSWAEPAETNGEITAYEVCYGL
VNEDNRPIGPMKKVLVDSPKKRTLLIENLRESQPYRYTVKARNGAGWGPEREAIINLATQ
PKRPMSIPIIPDIPIVDAQGGEDYEHFLMYSDDVLRSPTGSQRPSVSDDAEHLVNGRMDF
AFPGSANSLHRTTVSNAAYGAHRSPHRSPHLPHRVLSTSSTLSRDYHSLTRTEPSRSGTL
PRDYSTLTSLSSQSSRLAAGVPNTPTRLVFSALGPTSLKVSWQEPQCERVLQGYSVEYQL
LNGGELRQLNIPNPSQTSVVLEDLLPNHSYVFRVRAQSQEGWGPEREGVITIESQVHPQS
PLCPLPGSAFTLSTPSAPGPLVFTALSPDSLQLSWERPRRPDGDILGYLVTCEMAHGGGP
ATTFLVDGDSPESRLTVPGLSENVPYKFKVQAKTTQGFGPEREGIITIESQDGGPFPQLG
SHSGLFQHPMPGEYSITTTHSSTTEPVLLDGLTLGSQHLEAHGSLTRHVTQEFVSRTLST
SGTLSTHVDRQFFQT
NT seq 5268 nt   +upstreamnt  +downstreamnt
atggcagggccgcatcccagctggtggaccaggctgctgctggcagccctgctgagcgtc
agcttccccggggacatggcgaacctctgcaagaaggcccaggtgaagagctgcacggag
tgcatccgcgtggacaaggactgcgcctactgcacggacgagatgttcaaggagcggcgc
tgcaacacccaggcagagctgctggctgcgggctgccggcaggggagcatggtggtcatg
gagagcagcttcgagatcacagaggaaacgcagatcgacaccaccctgcgccgcagccag
gtgtccccccaggggctgcgggtgcggctgcggccgggagaggagcggcactttgagctg
caggtgtttgagcccctggagagccccatggacctgtatatcctcatggacttctccaac
tccatgtctgacgatctggacaacctcaagaagatggggcaggatctggcccaggtcctg
aatcagctcaccagcgactacacgattggatttggcaagttcgtggacaaagtcagcatc
cctcagacagacatgaggcccgagaagctgaaggagccctggcccaacagtgaacccccc
ttctccttcaaaaacgtcatcagcctgacggaagacgtagaggagttccggaacaagcta
aagggagagcggatctcaggcaacctggacgcccccgaaggaggtttcgatgccatcctg
cagacggccgtgtgcaccagggacatcggctggcgccccgacagcacccacttgctggtg
ttctctaccgagtcggccttccactacgaggcggacggcgccaacgtgctcgctggtatc
atgaggcgcaacgacgaggagtgccacctggacgccacgggcacctacacccagtacagg
acacaggactacccgtcggtgcccaccttggtgcgcctgctcggccagcacaacatcatc
cccattttcgcggtcaccaactactcctatagttactacgagaagctgtcctcgtatttt
cctgtctcttcgctgggggtgctgcaggaggactcctccaacatcgtggatctgctgcag
gatgccttcaaccgcatccgctccaacctggacatccgggctctggaaagcccccgaggc
ctgcggacagaggtcacctccaggatgttccagaagacgaacactgggtcctttctcatc
cggcgcggggaagtgggcacataccaagtgcagctgcgggccatcgaggacttggacggg
actcatgtgtgccagttgccagaagcggaccggaagggcaacatccatctgaagccctcc
ttctccaatggcctcaagatggacgtggacatcatctgtgacgtgtgctcctgtgagctg
caaaaacaggagcggtcatctcactgcagcttcaatggggacttcatgtgcggacactgt
gtgtgcaatgagggctggagcggcaagacctgtaactgctccactggctccctgagtgac
ctggcgccctgccaccgggagggagaagacaagctgtgctcggggcagggcgagtgccag
tgtggccactgcgtgtgctatggcgaaggccgctatgagggtgaattctgcgaatacgac
aacttccagtgcccccgtgcctccgggttcctctgcaacgaccggggacgctgctccatg
ggccagtgtgtgtgtgagcctggctggacaggcttgagctgtgactgtcctctcagcaat
gccacctgcatcgacagcaatgggggtatctgtaatgggcgtggctactgcgagtgtggc
cgctgccactgcaaccaacagtcgctctacacagacaccatctgcgaaatcaactactca
gcgatccgcctgggcctctgtgaggacctgcgctcctgtgtgcagtgccaggcgtggggc
accggtgaaaagaaggggcacacgtgtaaggagtgcagcttcaaggtcaagatggtggat
gagcttaagaaagcggaggaggtggtggagtactgctccttccgggacgaggatgacgac
tgcacgtacagttacaccgtggagggtgatggcgcccccgggcccaacagcaccgtcctg
gtgcagcggaggaaggactgccctcccggcagcttctggtggctcatcccgttgcttatc
ttcctcctgttgttcctggcactgctgctgccactttgctggaagtactgcgcctgctgc
aaggcctgcctggcccttctcccgtgctgcaaccgaggccacatggtgggcttcaaggaa
gaccactacatgctgcgcgagaacctgatggcctcggatcacctggacacgcccatgctg
cgcagcgggaacctcaaggggcgtgacatggtccgctggaagatcaccaacaacgtgcag
cggcctggctttgcctcgcatgctgctggcatcaaccccacggagctggcgccctacggg
ctgtccctgcgccttgcccgcctttgcaccgagaacctactgaagcctggcacccgagaa
tgtggccagctgcgccaggaagtggaggagaacctgaacgaggtgtacaggcatatcaca
ggcgcgcagaagctccagcagaccaagttccggcagcagcccaatgccgggaaaaagcag
gaccacaccattgtggacacggtgctgatggcgccccgctcggccaagcaggccctgctg
aagctgacggagaagcatgtgcagcagggggccttccatgagctcaaggtggcccctggc
tactacaccctcactgcagaccaggacgcccggggcatggtggagttccaggagggcgtg
gagctggtggacgtgcgggtgcctctcttcatccggcctgaggacgatgacgagaagcag
ctgctggtggaggccatcgacgtgcccgtgggcactgccaccctcggccgccgcctggtc
aacgtcaccatcctcaaggagcaagccagcgggatcgtgtcctttgagcagcctgagtac
ttggtcagccgcggggagcacgtggcccgcatccccatcatccggcgtatcctggacaac
ggcaagtcccaggtctcctactgcacgcaggacaacacagcgcagggcaaccgggactac
atccccacagagggcgaactgctgttccaacctggggagacctggaaggagctgcaggtg
aaggtcctggagctgcaggagatggactccctcctgcggggctgccagacccgccgcttc
tacatccaactcagcaaccccaagtttggggcccgcctgggccagccccagtctgccact
gtcatcattggggacagagatgaactggacgggaacttaatgggccagaccctgtcatca
ctcccactcccccggggtgacctgggtgccccacagaaccccaatgccaaggccaccggg
tcccggaagatccacttcaactggctgccccctcctggcaagccaacagggtaccgggtg
aagtactggatccagggtgactctgagtccgaagcccacctcctcgacagtaaggtgccc
tcggtggagctcaccaacctgtacccgtattgcgactacgagatgaaggtgtgcgcctac
ggcgcgcagggcgagggcccctacagctccctggtgtcgtgtcgcactcacccggaagtt
cccagcgagccggggcgtctggccttcaatgtcgtctcctccaccgtgacccagctgagc
tgggctgagccggccgagaccaatggcgagatcacagcctatgaagtctgctatggcctg
gtcaacgaggacaaccgacccatcgggcccatgaagaaggtgctggtggacagccccaag
aagaggacgctgctcattgagaacctgcgggagtcccagccgtaccgctacacggtcaag
gctcgcaacggggcgggctgggggcctgagcgggaggccatcatcaacctggccacccag
cccaagcggcccatgtccatccctatcatcccggacatccccatcgtggacgcccagggc
ggagaagactacgaacacttcctcatgtacagcgatgacgtgctccgctcgccgacaggc
agccagaggcccagcgtctctgatgacgccgagcacctggtgaacgggaggatggacttt
gccttcccgggcagcgccaactccctgcacaggacgactgtgagcaacgctgcctacggc
gcccaccggagcccccaccggagcccccacctgccccaccgcgtgctgagcacgtcctcc
accctctcgcgggactaccactcgctgacccgcacggagccctcgcgctcgggcacgctg
cccagggactactcgaccctcacctccctctcctcccagagctcccgcttggctgcaggt
gtgcccaacacacccacccgcctggtgttctcagccctgggacccacgtctctgaaagta
agctggcaggagccgcagtgtgagcgggtgctgcagggctacagcgtggagtaccagctg
ctgaatggcggtgagctgcgtcagcttaacatccccaaccccagccagacttcggtggtg
ctggaagacctcctgcccaaccactcctacgtgttccgcgtgcgggcccagagccaggaa
ggctggggcccagagcgcgagggtgtcatcaccatcgagtcacaggtgcacccacagagc
ccactttgccccctaccgggctctgccttcactttgagcacgcccagtgccccgggccca
ctggtgtttactgccctgagcccagactctctgcagttgagctgggagcggccgcgcagg
cctgatggcgacatcctcggctacctggtgacttgcgagatggcccacggaggagggcca
gccaccacgttcctggtggatggcgacagccccgagagccggctgaccgtgccaggcctc
agcgagaacgtgccctacaagttcaaggtgcaggccaagaccacccaaggtttcgggccg
gagcgtgagggtatcatcaccatcgagtcccaggatggaggccccttcccacagctgggc
agccactcggggctcttccagcacccaatgccaggagagtacagcatcaccaccacccac
tccagcaccactgagcccgtcctactggacggattgaccctggggtcccaacacttggaa
gcccatggctccctcacccggcacgtgacccaggagtttgtgagccggacactgagcact
agtggaaccctcagcacccacgtggaccgacagttctttcagacctga

KEGG   Physeter catodon (sperm whale): 102988740
Entry
102988740         CDS       T06011                                 

Gene name
ITGB3
Definition
(RefSeq) integrin beta-3 isoform X2
  KO
K06493  integrin beta 3
Organism
pcad  Physeter catodon (sperm whale)
Pathway
pcad04015  Rap1 signaling pathway
pcad04145  Phagosome
pcad04151  PI3K-Akt signaling pathway
pcad04380  Osteoclast differentiation
pcad04510  Focal adhesion
pcad04512  ECM-receptor interaction
pcad04611  Platelet activation
pcad04613  Neutrophil extracellular trap formation
pcad04640  Hematopoietic cell lineage
pcad04810  Regulation of actin cytoskeleton
pcad04919  Thyroid hormone signaling pathway
pcad05163  Human cytomegalovirus infection
pcad05165  Human papillomavirus infection
pcad05168  Herpes simplex virus 1 infection
pcad05205  Proteoglycans in cancer
pcad05206  MicroRNAs in cancer
pcad05410  Hypertrophic cardiomyopathy
pcad05412  Arrhythmogenic right ventricular cardiomyopathy
pcad05414  Dilated cardiomyopathy
pcad05418  Fluid shear stress and atherosclerosis
Brite
KEGG Orthology (KO) [BR:pcad00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04015 Rap1 signaling pathway
    102988740 (ITGB3)
   04151 PI3K-Akt signaling pathway
    102988740 (ITGB3)
  09133 Signaling molecules and interaction
   04512 ECM-receptor interaction
    102988740 (ITGB3)
 09140 Cellular Processes
  09141 Transport and catabolism
   04145 Phagosome
    102988740 (ITGB3)
  09144 Cellular community - eukaryotes
   04510 Focal adhesion
    102988740 (ITGB3)
  09142 Cell motility
   04810 Regulation of actin cytoskeleton
    102988740 (ITGB3)
 09150 Organismal Systems
  09151 Immune system
   04640 Hematopoietic cell lineage
    102988740 (ITGB3)
   04611 Platelet activation
    102988740 (ITGB3)
   04613 Neutrophil extracellular trap formation
    102988740 (ITGB3)
  09152 Endocrine system
   04919 Thyroid hormone signaling pathway
    102988740 (ITGB3)
  09158 Development and regeneration
   04380 Osteoclast differentiation
    102988740 (ITGB3)
 09160 Human Diseases
  09161 Cancer: overview
   05206 MicroRNAs in cancer
    102988740 (ITGB3)
   05205 Proteoglycans in cancer
    102988740 (ITGB3)
  09166 Cardiovascular disease
   05418 Fluid shear stress and atherosclerosis
    102988740 (ITGB3)
   05410 Hypertrophic cardiomyopathy
    102988740 (ITGB3)
   05412 Arrhythmogenic right ventricular cardiomyopathy
    102988740 (ITGB3)
   05414 Dilated cardiomyopathy
    102988740 (ITGB3)
  09172 Infectious disease: viral
   05168 Herpes simplex virus 1 infection
    102988740 (ITGB3)
   05163 Human cytomegalovirus infection
    102988740 (ITGB3)
   05165 Human papillomavirus infection
    102988740 (ITGB3)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04131 Membrane trafficking [BR:pcad04131]
    102988740 (ITGB3)
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:pcad04147]
    102988740 (ITGB3)
   04515 Cell adhesion molecules [BR:pcad04515]
    102988740 (ITGB3)
   04090 CD molecules [BR:pcad04090]
    102988740 (ITGB3)
Membrane trafficking [BR:pcad04131]
 Endocytosis
  Phagocytosis
   Integrins (complement receptors)
    102988740 (ITGB3)
Exosome [BR:pcad04147]
 Exosomal proteins
  Exosomal proteins of haemopoietic cells  (B-cell, T-cell, DC-cell, reticulocyte, and mast cell)
   102988740 (ITGB3)
Cell adhesion molecules [BR:pcad04515]
 Integrins
  Integrin beta subunits
   102988740 (ITGB3)
CD molecules [BR:pcad04090]
 Proteins
  102988740 (ITGB3)
SSDB
Motif
Pfam: Integrin_beta Integrin_B_tail Integrin_b_cyt I-EGF_1 PSI_integrin EGF_2
Other DBs
NCBI-GeneID: 102988740
NCBI-ProteinID: XP_007100294
UniProt: A0A2Y9ED82
LinkDB
Position
14
AA seq 784 aa
MRARPLWAAVLVLGALAGVGVGGPNICATRGVSSCQQCLAVSPICAWCSDEALPPGSPRC
NLKENLLKDDCALETIEFPISEARILEARPLSDKGSGDSSQITQVSPQRIVLRLRPDDSK
NFSIQVRQVEDYPVDIYYLMDLSYSMKDDLWSIQNLGTKLASQMRKLTSNLRIGFGAFVD
KPVSPYMYISPPEALKNPCYDMKTTCLPMFGYKHVLTLTDQVTRFNEEVKKQSVSRNRDA
PEGGFDAIMQATVCDEKIGWRNDASHLLVFTTDAKTHIALDGRLAGIVQPNDGQCHVGSD
NHYAASTTMDYPSLGLMTEKLSQKNINLIFAVTENVVNLYQNYSELIPGTTVGVLSTDSS
NVLQLIVDAYGKIRSKVELEVRDLPEELSLSFNATCLNNEVIPGLKSCVGLKIGDTVSFS
IEAKVRGCPQEKEKSFTIKPVGFKDSLTVQVTFDCDCACQAQAEPHSHHCNNGNGTFECG
VCRCGPGWLGSQCECSEEDYRPSQQDECSPREGQPICSQRGECLCGQCVCHSSDFGKITG
KYCECDDFSCVRYKGEMCSGHGQCSCGDCLCDSDWTGYYCNCTTRTDTCMSSNGLLCSGR
GKCECGSCVCIQPGSYGDTCEKCPTCPDACTFKKECVECKKFNRGALYEENTCNRYCRDE
IEPVKELKDTGKDAVNCTYKNEEDCVVRFQYYEDSSGKSILYVVEEPECPKGPDILVVLL
SVMGAILLIGLATLLIWKLLITIHDRKEFAKFEEERARAKWDTANNPLYKEATSTFTNIT
YRGT
NT seq 2355 nt   +upstreamnt  +downstreamnt
atgcgagcgcggccgctgtgggccgctgtgctggtgctgggggcgctggcgggcgtcggc
gtcggagggcccaacatctgtgccacacgaggcgtgagctcctgccagcaatgtctggct
gtgagtcccatctgtgcctggtgctcagatgaggctctgcctccgggctcgccccgctgt
aacctgaaggagaatctgctgaaggatgactgtgccctggagaccatcgagttccccatc
agcgaggccagaatcctggaggccaggcccctcagtgacaagggctctggagacagctcc
cagatcactcaagtcagtccccagaggattgtgctccggctacggccagatgattcgaag
aatttctccatccaagttcggcaggtggaggattaccccgtggacatctactacttaatg
gacctgtcttattccatgaaggatgatctgtggagcatccagaacctgggtaccaagctg
gcctcccagatgcgtaagctcaccagtaacctgcggattggcttcggggcctttgtggac
aagcccgtttcaccatacatgtacatctccccgccagaggccctcaaaaacccctgctat
gatatgaagaccacctgtttgcccatgtttggctacaaacatgtgctgacgctaactgac
caggtgacccgtttcaatgaagaagtgaagaagcagagtgtgtcacgaaaccgagatgcc
ccagagggtggctttgatgccatcatgcaggctaccgtctgtgatgagaagattggctgg
aggaatgatgcctcccacttgctggtgtttaccactgatgccaagacccatatagcgctg
gatggaaggctggcaggcattgtccagcccaacgatgggcagtgtcatgtgggcagtgac
aaccattatgctgcctccactaccatggattatccctctctggggctgatgaccgagaag
ctgtcccagaaaaacatcaatttgatctttgcagtgactgaaaatgtagtcaatctctac
cagaactatagtgagctcatcccagggaccacagtgggggttctgtctactgattccagc
aatgtcctccagctcattgttgatgcttacgggaaaatccgctctaaagtagagctggaa
gtgcgtgacctccctgaggagttgtccttatccttcaacgccacctgtctcaacaacgag
gtcatcccaggccttaagtcttgtgtcggactcaagattggagacacggtgagcttcagc
attgaggccaaggtgcgtggctgcccccaggagaaggagaagtccttcaccatcaagcct
gtgggcttcaaagacagcctcaccgtccaggtcaccttcgactgtgactgtgcctgccag
gcccaggctgagcctcacagccaccactgcaacaacggcaacgggacctttgagtgtggg
gtgtgccgctgcgggcctggctggctggggtcccagtgtgagtgctcagaagaggactac
cgtccctcccagcaggacgagtgtagcccccgggagggccagcccatctgcagccagcgg
ggcgagtgtctctgtggccagtgcgtctgccacagcagtgactttggcaagatcacgggc
aagtactgcgagtgtgatgacttctcctgtgtccgctacaagggggagatgtgctcaggc
catggccagtgcagctgtggggactgcctgtgtgactccgactggaccggctactactgc
aactgtaccacacgcacggacacctgcatgtccagcaatgggctgctgtgcagcgggcgg
ggcaagtgtgaatgcggcagctgcgtctgcatccagccgggctcctacggggacacctgt
gagaagtgtcccacctgccctgatgcctgcacctttaagaaggagtgtgtggagtgtaag
aagtttaaccgaggagccctatacgaggagaatacctgcaaccgttactgtcgtgatgag
attgagcctgtgaaggagcttaaggacactggaaaggatgctgtgaattgtacctacaag
aatgaggaggactgtgtcgtcagattccagtactatgaagactccagtggaaagtccatc
ctgtatgtggtagaagagcccgagtgtcccaagggccctgacatcctggtggtcctgctt
tcagtgatgggggccattctgctcatcggccttgctaccctgctcatctggaagctcctc
atcaccatccatgaccggaaggagtttgctaaatttgaggaagagagagccagagccaaa
tgggacacagccaacaacccactgtataaagaggccacgtccaccttcaccaacatcacc
tatcggggcacttaa

KEGG   Physeter catodon (sperm whale): 102992382
Entry
102992382         CDS       T06011                                 

Gene name
ITGB6
Definition
(RefSeq) integrin beta-6 isoform X1
  KO
K06589  integrin beta 6
Organism
pcad  Physeter catodon (sperm whale)
Pathway
pcad04151  PI3K-Akt signaling pathway
pcad04510  Focal adhesion
pcad04512  ECM-receptor interaction
pcad04810  Regulation of actin cytoskeleton
pcad05165  Human papillomavirus infection
pcad05410  Hypertrophic cardiomyopathy
pcad05412  Arrhythmogenic right ventricular cardiomyopathy
pcad05414  Dilated cardiomyopathy
Brite
KEGG Orthology (KO) [BR:pcad00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04151 PI3K-Akt signaling pathway
    102992382 (ITGB6)
  09133 Signaling molecules and interaction
   04512 ECM-receptor interaction
    102992382 (ITGB6)
 09140 Cellular Processes
  09144 Cellular community - eukaryotes
   04510 Focal adhesion
    102992382 (ITGB6)
  09142 Cell motility
   04810 Regulation of actin cytoskeleton
    102992382 (ITGB6)
 09160 Human Diseases
  09166 Cardiovascular disease
   05410 Hypertrophic cardiomyopathy
    102992382 (ITGB6)
   05412 Arrhythmogenic right ventricular cardiomyopathy
    102992382 (ITGB6)
   05414 Dilated cardiomyopathy
    102992382 (ITGB6)
  09172 Infectious disease: viral
   05165 Human papillomavirus infection
    102992382 (ITGB6)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:pcad04147]
    102992382 (ITGB6)
   04515 Cell adhesion molecules [BR:pcad04515]
    102992382 (ITGB6)
Exosome [BR:pcad04147]
 Exosomal proteins
  Exosomal proteins of epithelial cells
   102992382 (ITGB6)
Cell adhesion molecules [BR:pcad04515]
 Integrins
  Integrin beta subunits
   102992382 (ITGB6)
SSDB
Motif
Pfam: Integrin_beta Integrin_B_tail PSI_integrin I-EGF_1 Integrin_b_cyt EGF_2
Other DBs
NCBI-GeneID: 102992382
NCBI-ProteinID: XP_028334148
UniProt: A0A455AEI2
LinkDB
Position
2
AA seq 789 aa
MGIELLCLFFLFLGRNDHVQGGCAMGDAETCEDCLLIGPQCAWCSQENFTHLSGVGERCD
TPANLLAKGCQLTFIENPVSQVEILINKPLSVGRQKNSSSIVQIAPQNLALKLRPGSEQT
LQVQVRQTEDYPVDLYYLMDLSASMDDDLNTIKELGSLLSKEMSKLTSNFRLGFGSFVEK
PISPFMKTTPEEIANPCSSIPYICLPTFGFKHILPLTNDAERFNEIVKNQKISANIDTPE
GGFDAIMQAAVCKEKIGWRNDSLHLLVFVSDADSHFGMDSKLAGIVIPNDGLCHLDSKNE
YSMSTVLEYPTIGQLIDKLVQNNVLLIFAVTQEQVHLYENYAKLIPGATVGVLQKDSGNI
LQLIISAYEELRSEVELEVLGDTEGLNLSFTAVCNTGTPFPHQKKCSHMKVGDTASFNVT
VSIPNCERRSRHIIIKPVGLGDALEILVSPECSCDCEKEVEVNSSRCSNGNGSFQCGVCA
CHPGHMGPHCECGEDTLSTDSCKEAPELPACSGRGDCYCGQCICHLSPYGDIYGPYCQCD
NFSCVRHRGLLCGDNGDCDCGECVCRSGWTGEYCNCTTSTEPCISEDGALCSGRGGCVCG
KCVCTNPGASGPTCERCPTCGDPCNSKWSCIECYLSADGQAQEDCVDKCKLAGATINEEA
DFSKDSSVSCSLRGENECLITFLITTDNEGKTIIHSINEKDCPKPPNIPMIMLGVSLAIL
LIGVVLLCIWKLLVSFHDRKEVAKFETERSKAKWQTTQNSVIVVKDSSHAALCCILHTST
AMDRRRSRS
NT seq 2370 nt   +upstreamnt  +downstreamnt
atggggattgaactgctttgcctgttctttctatttctaggaaggaatgatcacgtacaa
ggtggctgtgccatgggggatgcagagacctgtgaggactgcttactcattggacctcag
tgtgcctggtgttctcaggagaattttacccatctatctggagttggagaaaggtgtgat
actccagcaaatcttttagctaaaggatgtcaactaaccttcatcgaaaaccctgtctcc
caagtagaaatacttataaataagcctctcagtgtaggcagacagaaaaatagttccagc
atcgttcagattgcccctcaaaacttggctcttaaactgagaccaggcagtgaacagact
ctgcaagttcaagttcgccagaccgaggattacccggtggacttgtattacctcatggac
ctctcagcctccatggacgatgacctcaacacaatcaaagagctaggctccctgctttcc
aaggagatgtctaaattaactagcaactttagactgggcttcggctcttttgtagaaaaa
cccatctccccttttatgaaaacaacaccagaagaaattgccaacccttgcagtagtatt
ccatacatttgtttacctacatttggattcaagcacattttgccgttgacaaatgatgca
gaaagattcaatgaaattgtgaagaatcagaaaatttctgctaatattgacaccccagaa
ggtggatttgatgcaattatgcaagctgctgtatgtaaggaaaaaattggctggcgtaac
gactccctccatctcctggtcttcgtgagcgatgccgattctcattttggaatggacagc
aaactggcaggcatcgtcattcctaacgatgggctctgtcacttggacagcaagaatgaa
tactccatgtcaacagtcttggaatatccaacaattggacaactcattgataaactggtg
caaaataacgtgttactgatctttgctgtaacccaagaacaagttcatttgtatgagaat
tatgcaaaactcattcctggagctacagtaggggtacttcagaaggactctggaaacatt
ctccagctgatcatctcggcttatgaagaactccggtctgaggtggagctggaggtgtta
ggagacacagaaggactcaacctgtcattcacagctgtctgtaataccgggacccccttt
ccacaccaaaagaaatgctctcacatgaaggtgggagacacagcttcgttcaatgtgact
gtgagtataccaaactgtgagagaagaagtaggcacattatcataaagcctgtggggctg
ggggacgccttggagatccttgtcagtccagaatgcagctgtgactgtgagaaggaagtg
gaggtgaacagctccagatgcagcaacgggaacggctccttccagtgtggagtgtgcgcc
tgccaccctggccacatgggtcctcactgcgagtgtggggaggacacgctgagcactgac
tcctgcaaggaggccccggaactccccgcatgcagtggaagaggcgattgctactgcggg
cagtgcatctgtcacttgtccccctatggagacatctacggcccttactgccagtgtgac
aatttctcctgcgtgagacacagagggctgctctgtggagataacggcgactgtgactgc
ggcgagtgcgtgtgcaggagcggctggacgggcgagtactgtaactgcaccaccagcacg
gagccctgcatctccgaagacggggcgctctgcagcgggcgagggggctgtgtgtgcggc
aagtgcgtttgcacgaaccccggagcctcgggacccacctgcgaacgttgtcccacctgt
ggcgatccctgtaactctaaatggagctgcattgaatgctacctgtctgcagatggccag
gcccaagaagactgtgttgacaaatgcaaattagctggtgcgaccatcaatgaagaagca
gatttctcaaaggatagttctgtttcctgttctctgcgaggagaaaatgaatgtcttatt
acattcctaataactacagataatgaagggaaaaccatcattcacagcattaatgagaaa
gactgtccaaaacctccgaatattcccatgatcatgttgggggtttcgctggctattctt
ctcattggagtcgtcctactgtgcatttggaagctgctggtgtcatttcatgatcggaaa
gaagttgccaaatttgaaacagaaaggtccaaggccaagtggcaaacgactcagaactct
gtgatcgtggtcaaggactcatcacacgctgctctctgttgcatcctccacaccagtact
gcgatggacagaagacgctcacgttcatag

KEGG   Physeter catodon (sperm whale): 102995205
Entry
102995205         CDS       T06011                                 

Gene name
ITGB5
Definition
(RefSeq) integrin beta-5
  KO
K06588  integrin beta 5
Organism
pcad  Physeter catodon (sperm whale)
Pathway
pcad04145  Phagosome
pcad04151  PI3K-Akt signaling pathway
pcad04510  Focal adhesion
pcad04512  ECM-receptor interaction
pcad04810  Regulation of actin cytoskeleton
pcad05165  Human papillomavirus infection
pcad05205  Proteoglycans in cancer
pcad05410  Hypertrophic cardiomyopathy
pcad05412  Arrhythmogenic right ventricular cardiomyopathy
pcad05414  Dilated cardiomyopathy
Brite
KEGG Orthology (KO) [BR:pcad00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04151 PI3K-Akt signaling pathway
    102995205 (ITGB5)
  09133 Signaling molecules and interaction
   04512 ECM-receptor interaction
    102995205 (ITGB5)
 09140 Cellular Processes
  09141 Transport and catabolism
   04145 Phagosome
    102995205 (ITGB5)
  09144 Cellular community - eukaryotes
   04510 Focal adhesion
    102995205 (ITGB5)
  09142 Cell motility
   04810 Regulation of actin cytoskeleton
    102995205 (ITGB5)
 09160 Human Diseases
  09161 Cancer: overview
   05205 Proteoglycans in cancer
    102995205 (ITGB5)
  09166 Cardiovascular disease
   05410 Hypertrophic cardiomyopathy
    102995205 (ITGB5)
   05412 Arrhythmogenic right ventricular cardiomyopathy
    102995205 (ITGB5)
   05414 Dilated cardiomyopathy
    102995205 (ITGB5)
  09172 Infectious disease: viral
   05165 Human papillomavirus infection
    102995205 (ITGB5)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04131 Membrane trafficking [BR:pcad04131]
    102995205 (ITGB5)
  09183 Protein families: signaling and cellular processes
   04515 Cell adhesion molecules [BR:pcad04515]
    102995205 (ITGB5)
Membrane trafficking [BR:pcad04131]
 Endocytosis
  Phagocytosis
   Integrins (complement receptors)
    102995205 (ITGB5)
Cell adhesion molecules [BR:pcad04515]
 Integrins
  Integrin beta subunits
   102995205 (ITGB5)
SSDB
Motif
Pfam: Integrin_beta I-EGF_1 EGF_2
Other DBs
NCBI-GeneID: 102995205
NCBI-ProteinID: XP_028348728
UniProt: A0A455BLH5
LinkDB
Position
1
AA seq 549 aa
MTPQEVTVNLRPGDKTTFQLQVRQVEDYPVDLYYLMDLSLSMKDDLDNIRSLGTKLAEEM
RKLTSNFRLGFGSFVDKNISPFSYTAPRYQTNPCIGSHSFVPLLPSSTDPINRDSKHLKS
EAMDQHSTEGYKLFPNCVPSFGFRHLLPLTDRVDSFNEEVRKQRVSRNRDAPEGGFDAVL
QAAVCKEKIGWRKDALHLLVFTTDDVPHIALDGKLGGLVQPHDGQCHLNEANEYTASNQM
DYPSLALLGEKLAENNINLIFAVTKNHYMLYKNFTALIPGTTVEILHGDSKNIIQLIINA
YNSIRSKVELSVWDQPEDINLFFTATCQDGVSYPGQRKCEGLKIGDTASFEVSVEARSCP
GKHAQPMFTLRPVGFRDSLEVGVTYNCRCSCSTGLEPDSARCSGNGTYVCGMCECNPSYL
GTRCECQEGESQSGYQNLCREAEGKPLCSGRGQCSCNQCSCFESEFGKIYGPFCECDNFS
CARNKGVLCSGRHPRKHLCSEPGTGLGAVWTSPKHAFYLLPQSSWEKTRASLGGGTSVSN
TKAGDGTAA
NT seq 1650 nt   +upstreamnt  +downstreamnt
atgacaccgcaggaggtcacggtgaacctgcggcccggtgacaagactaccttccagctg
caggttcgacaggtggaggattatccagtggacttgtactacctgatggacctctctctg
tccatgaaggatgacttggacaacattcggagcctgggcaccaagcttgccgaggagatg
aggaaactcaccagcaacttccgcttggggtttgggtcttttgtagacaagaacatctct
cctttctcctacacagcgccaaggtaccagaccaacccgtgcattggcagtcatagtttt
gttcctctcctcccttcctcaaccgaccccatcaaccgagacagtaaacacctgaagtcc
gaagccatggaccagcacagcacagaaggttacaagctattcccaaactgtgtcccctcc
tttgggttccgccatctgctgcctctcacagacagagtggacagcttcaacgaggaagtt
cggaagcagagggtgtcccggaaccgcgatgcccccgagggcggctttgatgcagtgctc
caggcggctgtctgcaaggagaagatcggctggcgaaaggacgcgctgcacttgctggtg
ttcacaacggatgacgtgccccacatcgcgctggacggaaagctgggtggcctggtgcag
cctcatgacggccagtgccacctgaatgaggccaacgagtacactgcctccaaccagatg
gactatccatcccttgccttgcttggagagaaactggcagaaaacaacatcaacctcatc
tttgcagtgacgaagaaccattatatgctctacaagaattttacagccctgatacctgga
acaacggtggagatattacacggagactccaaaaatataattcaactgattatcaatgca
tacaacagcatccggtctaaagtggagctgtccgtctgggatcagcctgaggatattaat
cttttcttcactgctacctgccaggatggtgtatcttaccctggtcagaggaagtgtgaa
ggcctgaagatcggggacacagcgtcctttgaggtgtcggtggaggcccggagttgcccg
ggcaaacacgcgcagcccatgttcaccctgcggcctgtgggattccgggacagcctggag
gtgggggtcacctacaactgcaggtgcagctgcagcactgggctggagccggacagcgcc
aggtgcagcggcaacgggacttacgtctgtggcatgtgtgagtgcaaccccagctacctg
ggcaccaggtgcgagtgccaggaaggggagagccagagcgggtaccagaacttgtgccga
gaagcggagggcaagcccctgtgcagcggacgcggtcagtgcagctgcaaccagtgctcc
tgcttcgagagcgagtttgggaagatctacgggcccttctgcgagtgcgacaacttctcc
tgcgccaggaacaaaggagtcctctgctcaggtaggcacccccgcaagcacttgtgctct
gagccaggcaccggcctgggtgccgtttggacatccccaaagcatgccttttacttactg
ccacagtcctcctgggaaaagacaagggcaagccttgggggtgggaccagtgtgtcgaat
acaaaagcaggagatggcactgctgcgtga

DBGET integrated database retrieval system