KEGG   Physeter catodon (sperm whale): 102976885
Entry
102976885         CDS       T06011                                 

Gene name
RPS6KB2
Definition
(RefSeq) ribosomal protein S6 kinase beta-2 isoform X1
  KO
K04688  ribosomal protein S6 kinase beta [EC:2.7.11.1]
Organism
pcad  Physeter catodon (sperm whale)
Pathway
pcad01521  EGFR tyrosine kinase inhibitor resistance
pcad01522  Endocrine resistance
pcad04012  ErbB signaling pathway
pcad04066  HIF-1 signaling pathway
pcad04140  Autophagy - animal
pcad04150  mTOR signaling pathway
pcad04151  PI3K-Akt signaling pathway
pcad04152  AMPK signaling pathway
pcad04211  Longevity regulating pathway
pcad04213  Longevity regulating pathway - multiple species
pcad04350  TGF-beta signaling pathway
pcad04371  Apelin signaling pathway
pcad04666  Fc gamma R-mediated phagocytosis
pcad04714  Thermogenesis
pcad04910  Insulin signaling pathway
pcad04931  Insulin resistance
pcad05163  Human cytomegalovirus infection
pcad05165  Human papillomavirus infection
pcad05170  Human immunodeficiency virus 1 infection
pcad05200  Pathways in cancer
pcad05205  Proteoglycans in cancer
pcad05210  Colorectal cancer
pcad05212  Pancreatic cancer
pcad05221  Acute myeloid leukemia
pcad05224  Breast cancer
pcad05225  Hepatocellular carcinoma
pcad05226  Gastric cancer
pcad05231  Choline metabolism in cancer
pcad05235  PD-L1 expression and PD-1 checkpoint pathway in cancer
Brite
KEGG Orthology (KO) [BR:pcad00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04012 ErbB signaling pathway
    102976885 (RPS6KB2)
   04350 TGF-beta signaling pathway
    102976885 (RPS6KB2)
   04371 Apelin signaling pathway
    102976885 (RPS6KB2)
   04066 HIF-1 signaling pathway
    102976885 (RPS6KB2)
   04151 PI3K-Akt signaling pathway
    102976885 (RPS6KB2)
   04152 AMPK signaling pathway
    102976885 (RPS6KB2)
   04150 mTOR signaling pathway
    102976885 (RPS6KB2)
 09140 Cellular Processes
  09141 Transport and catabolism
   04140 Autophagy - animal
    102976885 (RPS6KB2)
 09150 Organismal Systems
  09151 Immune system
   04666 Fc gamma R-mediated phagocytosis
    102976885 (RPS6KB2)
  09152 Endocrine system
   04910 Insulin signaling pathway
    102976885 (RPS6KB2)
  09149 Aging
   04211 Longevity regulating pathway
    102976885 (RPS6KB2)
   04213 Longevity regulating pathway - multiple species
    102976885 (RPS6KB2)
  09159 Environmental adaptation
   04714 Thermogenesis
    102976885 (RPS6KB2)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    102976885 (RPS6KB2)
   05205 Proteoglycans in cancer
    102976885 (RPS6KB2)
   05231 Choline metabolism in cancer
    102976885 (RPS6KB2)
   05235 PD-L1 expression and PD-1 checkpoint pathway in cancer
    102976885 (RPS6KB2)
  09162 Cancer: specific types
   05210 Colorectal cancer
    102976885 (RPS6KB2)
   05212 Pancreatic cancer
    102976885 (RPS6KB2)
   05225 Hepatocellular carcinoma
    102976885 (RPS6KB2)
   05226 Gastric cancer
    102976885 (RPS6KB2)
   05221 Acute myeloid leukemia
    102976885 (RPS6KB2)
   05224 Breast cancer
    102976885 (RPS6KB2)
  09167 Endocrine and metabolic disease
   04931 Insulin resistance
    102976885 (RPS6KB2)
  09172 Infectious disease: viral
   05170 Human immunodeficiency virus 1 infection
    102976885 (RPS6KB2)
   05163 Human cytomegalovirus infection
    102976885 (RPS6KB2)
   05165 Human papillomavirus infection
    102976885 (RPS6KB2)
  09176 Drug resistance: antineoplastic
   01521 EGFR tyrosine kinase inhibitor resistance
    102976885 (RPS6KB2)
   01522 Endocrine resistance
    102976885 (RPS6KB2)
Enzymes [BR:pcad01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.11  Protein-serine/threonine kinases
    2.7.11.1  non-specific serine/threonine protein kinase
     102976885 (RPS6KB2)
Protein kinases [BR:pcad01001]
 Serine/threonine kinases: AGC group
  RSK family [OT]
   102976885 (RPS6KB2)
SSDB
Motif
Pfam: Pkinase PK_Tyr_Ser-Thr Pkinase_C Kinase-like Pkinase_fungal Seadorna_VP7 Kdo
Other DBs
NCBI-GeneID: 102976885
NCBI-ProteinID: XP_007127005
UniProt: A0A2Y9FQ50
LinkDB
Position
Unknown
AA seq 489 aa
MAAVFDLDLETEEGSEGEGEPEFSPADVCPLAELRAAGLEPVGHYEEVELTESSVNPGPE
RIGPHCFELLRVLGKGNYGKVFQVRKVQGTNVGRIYAMKVLRKAKIVRNAKDTAHTRAER
NILESVKHPFIVELAYAFQTGGKLYLILECLSGGELFTHLEREGIFLEDTACFYLSEITL
ALGHLHSQGIIYRDLKPENIMLNSQGHIKLTDFGLCKESIHEGAVTHTFCGTIEYMAPEI
LVRSGHNRAVDWWSLGALMYDMLTGSPPFTAENRKKTMDKIIRGKLELPAYLTPDARDLV
KKFLKRNPSHRIGGGPGDAADVQRHPFFRHVDWDALLARRVDPPFRPSLQSEEDVSQFDS
HFTRQTPVDSPDDTSLSESANQAFLGFTYVAPSVLDSIKEAFSFQPKLRSPRRLNSSPWT
PISPLKFSPSEGFRPSPGPPEPMEPPLPPLLLPPPPPPPPPPPSSTAPLPIRPPSGTKKS
KKGRGRPGR
NT seq 1470 nt   +upstreamnt  +downstreamnt
atggcggcggtgtttgacctggacctggagacggaggaaggcagcgagggcgagggcgag
ccagagtttagccccgcggacgtgtgtccccttgccgagttgagggcggctggcctggag
cctgtgggacactatgaggaggtggagctgactgagagcagtgtgaacccgggccctgag
cgcatcgggccccactgctttgagctgctgcgcgtgctgggcaaggggaactatggcaag
gtgttccaggtgcgaaaggtgcagggcaccaatgtgggcagaatatatgccatgaaagtc
ctgaggaaggccaaaattgtgcgcaacgccaaggacacggcacacacgcgggctgagcgg
aacattctagagtcagtgaagcaccccttcattgtggaactggcctatgccttccagact
ggtggcaaactctacctcatcctggagtgcctcagtggcggcgagctcttcacacatctg
gagcgagagggcatcttcctggaagatacggcctgtttctacctgtcagagatcacactg
gccctgggccatctccactcccaaggcatcatctaccgggatctcaaacctgagaacatc
atgctgaacagccagggtcacatcaaactgacggacttcggcctctgcaaggagtcgatt
cacgagggtgccgtcacccacaccttctgcggcaccatcgagtacatggcccctgagatt
ctggtgcgcagtggccacaaccgggcggtggactggtggagcttgggggccctgatgtac
gacatgctcactggatcgccacccttcactgcagagaaccggaagaaaaccatggacaag
atcatcagagggaagctggagctgcccgcctacctcaccccagatgcccgggaccttgtc
aaaaagtttctgaagcggaatcccagccaccgtatcgggggtggccccggggacgccgct
gatgtgcagaggcaccccttcttccggcacgttgattgggacgccctcctggcccgccgc
gtggacccccctttccggccctccctgcagtcggaggaggacgtgagccagtttgactcc
cacttcacgaggcagacgccggtggacagtccagacgacacgtccctcagtgagagcgcc
aaccaggccttcctgggcttcacgtacgtggcgccctccgtcctggacagcatcaaggag
gccttctccttccagcccaaactgcgctcccccaggcgcctcaacagcagcccctggacc
cccatcagccccctgaagttctcgccctctgagggattccgacccagccccggcccaccg
gagcccatggagccccctctaccccctctcctgctgccgccgccgccgccaccgccgccg
ccaccgccctcgagcactgcccccctccccatccgacccccctcagggaccaagaagtcc
aagaaaggccgtgggcgccccgggcgctaa

KEGG   Physeter catodon (sperm whale): 102990399
Entry
102990399         CDS       T06011                                 

Gene name
RPS6KB1
Definition
(RefSeq) ribosomal protein S6 kinase beta-1 isoform X1
  KO
K04688  ribosomal protein S6 kinase beta [EC:2.7.11.1]
Organism
pcad  Physeter catodon (sperm whale)
Pathway
pcad01521  EGFR tyrosine kinase inhibitor resistance
pcad01522  Endocrine resistance
pcad04012  ErbB signaling pathway
pcad04066  HIF-1 signaling pathway
pcad04140  Autophagy - animal
pcad04150  mTOR signaling pathway
pcad04151  PI3K-Akt signaling pathway
pcad04152  AMPK signaling pathway
pcad04211  Longevity regulating pathway
pcad04213  Longevity regulating pathway - multiple species
pcad04350  TGF-beta signaling pathway
pcad04371  Apelin signaling pathway
pcad04666  Fc gamma R-mediated phagocytosis
pcad04714  Thermogenesis
pcad04910  Insulin signaling pathway
pcad04931  Insulin resistance
pcad05163  Human cytomegalovirus infection
pcad05165  Human papillomavirus infection
pcad05170  Human immunodeficiency virus 1 infection
pcad05200  Pathways in cancer
pcad05205  Proteoglycans in cancer
pcad05210  Colorectal cancer
pcad05212  Pancreatic cancer
pcad05221  Acute myeloid leukemia
pcad05224  Breast cancer
pcad05225  Hepatocellular carcinoma
pcad05226  Gastric cancer
pcad05231  Choline metabolism in cancer
pcad05235  PD-L1 expression and PD-1 checkpoint pathway in cancer
Brite
KEGG Orthology (KO) [BR:pcad00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04012 ErbB signaling pathway
    102990399 (RPS6KB1)
   04350 TGF-beta signaling pathway
    102990399 (RPS6KB1)
   04371 Apelin signaling pathway
    102990399 (RPS6KB1)
   04066 HIF-1 signaling pathway
    102990399 (RPS6KB1)
   04151 PI3K-Akt signaling pathway
    102990399 (RPS6KB1)
   04152 AMPK signaling pathway
    102990399 (RPS6KB1)
   04150 mTOR signaling pathway
    102990399 (RPS6KB1)
 09140 Cellular Processes
  09141 Transport and catabolism
   04140 Autophagy - animal
    102990399 (RPS6KB1)
 09150 Organismal Systems
  09151 Immune system
   04666 Fc gamma R-mediated phagocytosis
    102990399 (RPS6KB1)
  09152 Endocrine system
   04910 Insulin signaling pathway
    102990399 (RPS6KB1)
  09149 Aging
   04211 Longevity regulating pathway
    102990399 (RPS6KB1)
   04213 Longevity regulating pathway - multiple species
    102990399 (RPS6KB1)
  09159 Environmental adaptation
   04714 Thermogenesis
    102990399 (RPS6KB1)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    102990399 (RPS6KB1)
   05205 Proteoglycans in cancer
    102990399 (RPS6KB1)
   05231 Choline metabolism in cancer
    102990399 (RPS6KB1)
   05235 PD-L1 expression and PD-1 checkpoint pathway in cancer
    102990399 (RPS6KB1)
  09162 Cancer: specific types
   05210 Colorectal cancer
    102990399 (RPS6KB1)
   05212 Pancreatic cancer
    102990399 (RPS6KB1)
   05225 Hepatocellular carcinoma
    102990399 (RPS6KB1)
   05226 Gastric cancer
    102990399 (RPS6KB1)
   05221 Acute myeloid leukemia
    102990399 (RPS6KB1)
   05224 Breast cancer
    102990399 (RPS6KB1)
  09167 Endocrine and metabolic disease
   04931 Insulin resistance
    102990399 (RPS6KB1)
  09172 Infectious disease: viral
   05170 Human immunodeficiency virus 1 infection
    102990399 (RPS6KB1)
   05163 Human cytomegalovirus infection
    102990399 (RPS6KB1)
   05165 Human papillomavirus infection
    102990399 (RPS6KB1)
  09176 Drug resistance: antineoplastic
   01521 EGFR tyrosine kinase inhibitor resistance
    102990399 (RPS6KB1)
   01522 Endocrine resistance
    102990399 (RPS6KB1)
Enzymes [BR:pcad01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.11  Protein-serine/threonine kinases
    2.7.11.1  non-specific serine/threonine protein kinase
     102990399 (RPS6KB1)
Protein kinases [BR:pcad01001]
 Serine/threonine kinases: AGC group
  RSK family [OT]
   102990399 (RPS6KB1)
SSDB
Motif
Pfam: Pkinase PK_Tyr_Ser-Thr Pkinase_C Kinase-like Pkinase_fungal APH
Other DBs
NCBI-GeneID: 102990399
NCBI-ProteinID: XP_007118395
UniProt: A0A2Y9FC81
LinkDB
Position
14
AA seq 525 aa
MRRRRRRDGFYPAPDFRDREAEDMAGVFDIDLDQPEDAGSEDELEEGGQLNESMDHGGVG
PYELGMEHCEKFEISETSVNRGPEKIRPECFELLRVLGKGGYGKVFQVRKVTGANTGKIF
AMKVLKKAMIVRNAKDTAHTKAERNILEEVKHPFIVDLIYAFQTGGKLYLILEYLSGGEL
FMQLEREGIFMEDTACFYLAEISMALGHLHQKGIIYRDLKPENIMLNHQGHVKLTDFGLC
KESIHDGTVTHTFCGTIEYMAPEILMRSGHNRAVDWWSLGALMYDMLTGAPPFTGENRKK
TIDKILKCKLNLPPYLTQEARDLLKKLLKRNAASRLGAGPGDAGEVQAHPFFRHINWEEL
LARKVEPPFKPLLQSEEDVSQFDSKFTRQTPVDSPDDSTLSESANQVFLGFTYVAPSVLE
SVKEKFSFEPKIRSPRRFIGSPRTPVSPVKFSPGDFWGRGASASTANPQAPVEYPMETSG
IEQMDVTTSGEASAPLPIRQPNSGPYKKQAFPMISKRPEHLRMNL
NT seq 1578 nt   +upstreamnt  +downstreamnt
atgaggcgacgacggaggcgggacggcttttacccagcgccggacttccgagacagggaa
gctgaggacatggcaggagtgtttgacatagacctggaccagccagaggacgcgggctct
gaggatgagctggaggaggggggtcagttaaatgaaagcatggaccatgggggagtcgga
ccatatgaacttggcatggagcattgtgagaaatttgaaatctcagaaactagtgtgaac
agagggccagaaaaaatcagaccagaatgttttgagctacttcgagtacttggtaaaggg
ggctatggaaaggtttttcaagtacgaaaagtaacaggagcaaataccgggaaaatattt
gccatgaaggtgcttaaaaaggcaatgatagtgagaaatgctaaagatacagctcataca
aaagcagaacggaatattctggaggaagtaaagcatcccttcattgtggatttaatttat
gcctttcagactggtggaaaactctacctcatccttgagtatctcagcggaggagaatta
tttatgcagttagaaagagaaggaatatttatggaagacacagcctgcttttacttggca
gaaatctccatggctttggggcatttacatcaaaaggggatcatctacagagacctgaag
ccggagaatatcatgcttaatcaccaaggtcatgtgaaactaacagattttggactatgc
aaagaatctattcatgatggaacagtcacgcacacattttgtggaacaatagaatacatg
gcccctgaaatcttgatgagaagtggccacaatcgtgctgtggattggtggagtctggga
gcattaatgtatgacatgctgactggagcacccccgttcactggggagaatagaaagaaa
acaattgacaaaatcctcaaatgtaaactcaatttgcctccctacctcacacaagaagcc
agagatctgcttaaaaagctgctgaaaagaaatgctgcttctcgtcttggagctggtcct
ggggacgctggagaagttcaagctcatccattcttcagacatattaactgggaagaactg
ctggctcggaaggtagagcccccctttaaacctctgttgcaatctgaagaggatgtgagt
cagtttgattcaaagtttacacgtcagacacctgttgacagcccagatgactcaactctc
agtgaaagtgccaaccaggtctttctgggttttacatatgtggctccatctgtacttgaa
agcgtgaaagaaaagttttcctttgaaccaaaaatccggtcacctcgaagatttattggc
agcccacgaacacctgtcagccctgtcaaattttctcctggggatttctggggaagaggt
gcttcagccagcacggcaaatcctcaggcgcctgtggaatacccaatggaaacaagtgga
atagagcagatggatgtgacgacgagtggggaagcttcagcaccacttccaatacgacag
ccgaactccgggccatacaaaaaacaagcttttcccatgatctccaaacgaccagaacac
ctgcgtatgaatctatga

DBGET integrated database retrieval system