KEGG   Physeter catodon (sperm whale): 102977108
Entry
102977108         CDS       T06011                                 

Gene name
PIK3CB
Definition
(RefSeq) phosphatidylinositol 4,5-bisphosphate 3-kinase catalytic subunit beta isoform
  KO
K00922  phosphatidylinositol-4,5-bisphosphate 3-kinase catalytic subunit alpha/beta/delta [EC:2.7.1.153]
Organism
pcad  Physeter catodon (sperm whale)
Pathway
pcad00562  Inositol phosphate metabolism
pcad01100  Metabolic pathways
pcad01521  EGFR tyrosine kinase inhibitor resistance
pcad01522  Endocrine resistance
pcad01524  Platinum drug resistance
pcad04012  ErbB signaling pathway
pcad04014  Ras signaling pathway
pcad04015  Rap1 signaling pathway
pcad04024  cAMP signaling pathway
pcad04062  Chemokine signaling pathway
pcad04066  HIF-1 signaling pathway
pcad04068  FoxO signaling pathway
pcad04070  Phosphatidylinositol signaling system
pcad04071  Sphingolipid signaling pathway
pcad04072  Phospholipase D signaling pathway
pcad04140  Autophagy - animal
pcad04150  mTOR signaling pathway
pcad04151  PI3K-Akt signaling pathway
pcad04152  AMPK signaling pathway
pcad04210  Apoptosis
pcad04211  Longevity regulating pathway
pcad04213  Longevity regulating pathway - multiple species
pcad04218  Cellular senescence
pcad04360  Axon guidance
pcad04370  VEGF signaling pathway
pcad04380  Osteoclast differentiation
pcad04510  Focal adhesion
pcad04550  Signaling pathways regulating pluripotency of stem cells
pcad04611  Platelet activation
pcad04620  Toll-like receptor signaling pathway
pcad04625  C-type lectin receptor signaling pathway
pcad04630  JAK-STAT signaling pathway
pcad04650  Natural killer cell mediated cytotoxicity
pcad04660  T cell receptor signaling pathway
pcad04662  B cell receptor signaling pathway
pcad04664  Fc epsilon RI signaling pathway
pcad04666  Fc gamma R-mediated phagocytosis
pcad04668  TNF signaling pathway
pcad04670  Leukocyte transendothelial migration
pcad04722  Neurotrophin signaling pathway
pcad04725  Cholinergic synapse
pcad04750  Inflammatory mediator regulation of TRP channels
pcad04810  Regulation of actin cytoskeleton
pcad04910  Insulin signaling pathway
pcad04914  Progesterone-mediated oocyte maturation
pcad04915  Estrogen signaling pathway
pcad04917  Prolactin signaling pathway
pcad04919  Thyroid hormone signaling pathway
pcad04923  Regulation of lipolysis in adipocytes
pcad04926  Relaxin signaling pathway
pcad04929  GnRH secretion
pcad04930  Type II diabetes mellitus
pcad04931  Insulin resistance
pcad04932  Non-alcoholic fatty liver disease
pcad04933  AGE-RAGE signaling pathway in diabetic complications
pcad04935  Growth hormone synthesis, secretion and action
pcad04960  Aldosterone-regulated sodium reabsorption
pcad04973  Carbohydrate digestion and absorption
pcad05010  Alzheimer disease
pcad05017  Spinocerebellar ataxia
pcad05020  Prion disease
pcad05100  Bacterial invasion of epithelial cells
pcad05132  Salmonella infection
pcad05135  Yersinia infection
pcad05142  Chagas disease
pcad05146  Amoebiasis
pcad05160  Hepatitis C
pcad05161  Hepatitis B
pcad05162  Measles
pcad05163  Human cytomegalovirus infection
pcad05164  Influenza A
pcad05165  Human papillomavirus infection
pcad05166  Human T-cell leukemia virus 1 infection
pcad05167  Kaposi sarcoma-associated herpesvirus infection
pcad05168  Herpes simplex virus 1 infection
pcad05169  Epstein-Barr virus infection
pcad05170  Human immunodeficiency virus 1 infection
pcad05171  Coronavirus disease - COVID-19
pcad05200  Pathways in cancer
pcad05203  Viral carcinogenesis
pcad05205  Proteoglycans in cancer
pcad05206  MicroRNAs in cancer
pcad05210  Colorectal cancer
pcad05211  Renal cell carcinoma
pcad05212  Pancreatic cancer
pcad05213  Endometrial cancer
pcad05214  Glioma
pcad05215  Prostate cancer
pcad05218  Melanoma
pcad05220  Chronic myeloid leukemia
pcad05221  Acute myeloid leukemia
pcad05222  Small cell lung cancer
pcad05223  Non-small cell lung cancer
pcad05224  Breast cancer
pcad05225  Hepatocellular carcinoma
pcad05226  Gastric cancer
pcad05230  Central carbon metabolism in cancer
pcad05231  Choline metabolism in cancer
pcad05235  PD-L1 expression and PD-1 checkpoint pathway in cancer
pcad05418  Fluid shear stress and atherosclerosis
Brite
KEGG Orthology (KO) [BR:pcad00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00562 Inositol phosphate metabolism
    102977108 (PIK3CB)
 09130 Environmental Information Processing
  09132 Signal transduction
   04012 ErbB signaling pathway
    102977108 (PIK3CB)
   04014 Ras signaling pathway
    102977108 (PIK3CB)
   04015 Rap1 signaling pathway
    102977108 (PIK3CB)
   04370 VEGF signaling pathway
    102977108 (PIK3CB)
   04630 JAK-STAT signaling pathway
    102977108 (PIK3CB)
   04668 TNF signaling pathway
    102977108 (PIK3CB)
   04066 HIF-1 signaling pathway
    102977108 (PIK3CB)
   04068 FoxO signaling pathway
    102977108 (PIK3CB)
   04070 Phosphatidylinositol signaling system
    102977108 (PIK3CB)
   04072 Phospholipase D signaling pathway
    102977108 (PIK3CB)
   04071 Sphingolipid signaling pathway
    102977108 (PIK3CB)
   04024 cAMP signaling pathway
    102977108 (PIK3CB)
   04151 PI3K-Akt signaling pathway
    102977108 (PIK3CB)
   04152 AMPK signaling pathway
    102977108 (PIK3CB)
   04150 mTOR signaling pathway
    102977108 (PIK3CB)
 09140 Cellular Processes
  09141 Transport and catabolism
   04140 Autophagy - animal
    102977108 (PIK3CB)
  09143 Cell growth and death
   04210 Apoptosis
    102977108 (PIK3CB)
   04218 Cellular senescence
    102977108 (PIK3CB)
  09144 Cellular community - eukaryotes
   04510 Focal adhesion
    102977108 (PIK3CB)
   04550 Signaling pathways regulating pluripotency of stem cells
    102977108 (PIK3CB)
  09142 Cell motility
   04810 Regulation of actin cytoskeleton
    102977108 (PIK3CB)
 09150 Organismal Systems
  09151 Immune system
   04611 Platelet activation
    102977108 (PIK3CB)
   04620 Toll-like receptor signaling pathway
    102977108 (PIK3CB)
   04625 C-type lectin receptor signaling pathway
    102977108 (PIK3CB)
   04650 Natural killer cell mediated cytotoxicity
    102977108 (PIK3CB)
   04660 T cell receptor signaling pathway
    102977108 (PIK3CB)
   04662 B cell receptor signaling pathway
    102977108 (PIK3CB)
   04664 Fc epsilon RI signaling pathway
    102977108 (PIK3CB)
   04666 Fc gamma R-mediated phagocytosis
    102977108 (PIK3CB)
   04670 Leukocyte transendothelial migration
    102977108 (PIK3CB)
   04062 Chemokine signaling pathway
    102977108 (PIK3CB)
  09152 Endocrine system
   04910 Insulin signaling pathway
    102977108 (PIK3CB)
   04923 Regulation of lipolysis in adipocytes
    102977108 (PIK3CB)
   04929 GnRH secretion
    102977108 (PIK3CB)
   04915 Estrogen signaling pathway
    102977108 (PIK3CB)
   04914 Progesterone-mediated oocyte maturation
    102977108 (PIK3CB)
   04917 Prolactin signaling pathway
    102977108 (PIK3CB)
   04926 Relaxin signaling pathway
    102977108 (PIK3CB)
   04935 Growth hormone synthesis, secretion and action
    102977108 (PIK3CB)
   04919 Thyroid hormone signaling pathway
    102977108 (PIK3CB)
  09154 Digestive system
   04973 Carbohydrate digestion and absorption
    102977108 (PIK3CB)
  09155 Excretory system
   04960 Aldosterone-regulated sodium reabsorption
    102977108 (PIK3CB)
  09156 Nervous system
   04725 Cholinergic synapse
    102977108 (PIK3CB)
   04722 Neurotrophin signaling pathway
    102977108 (PIK3CB)
  09157 Sensory system
   04750 Inflammatory mediator regulation of TRP channels
    102977108 (PIK3CB)
  09158 Development and regeneration
   04360 Axon guidance
    102977108 (PIK3CB)
   04380 Osteoclast differentiation
    102977108 (PIK3CB)
  09149 Aging
   04211 Longevity regulating pathway
    102977108 (PIK3CB)
   04213 Longevity regulating pathway - multiple species
    102977108 (PIK3CB)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    102977108 (PIK3CB)
   05206 MicroRNAs in cancer
    102977108 (PIK3CB)
   05205 Proteoglycans in cancer
    102977108 (PIK3CB)
   05203 Viral carcinogenesis
    102977108 (PIK3CB)
   05230 Central carbon metabolism in cancer
    102977108 (PIK3CB)
   05231 Choline metabolism in cancer
    102977108 (PIK3CB)
   05235 PD-L1 expression and PD-1 checkpoint pathway in cancer
    102977108 (PIK3CB)
  09162 Cancer: specific types
   05210 Colorectal cancer
    102977108 (PIK3CB)
   05212 Pancreatic cancer
    102977108 (PIK3CB)
   05225 Hepatocellular carcinoma
    102977108 (PIK3CB)
   05226 Gastric cancer
    102977108 (PIK3CB)
   05214 Glioma
    102977108 (PIK3CB)
   05221 Acute myeloid leukemia
    102977108 (PIK3CB)
   05220 Chronic myeloid leukemia
    102977108 (PIK3CB)
   05218 Melanoma
    102977108 (PIK3CB)
   05211 Renal cell carcinoma
    102977108 (PIK3CB)
   05215 Prostate cancer
    102977108 (PIK3CB)
   05213 Endometrial cancer
    102977108 (PIK3CB)
   05224 Breast cancer
    102977108 (PIK3CB)
   05222 Small cell lung cancer
    102977108 (PIK3CB)
   05223 Non-small cell lung cancer
    102977108 (PIK3CB)
  09164 Neurodegenerative disease
   05010 Alzheimer disease
    102977108 (PIK3CB)
   05017 Spinocerebellar ataxia
    102977108 (PIK3CB)
   05020 Prion disease
    102977108 (PIK3CB)
  09166 Cardiovascular disease
   05418 Fluid shear stress and atherosclerosis
    102977108 (PIK3CB)
  09167 Endocrine and metabolic disease
   04930 Type II diabetes mellitus
    102977108 (PIK3CB)
   04932 Non-alcoholic fatty liver disease
    102977108 (PIK3CB)
   04931 Insulin resistance
    102977108 (PIK3CB)
   04933 AGE-RAGE signaling pathway in diabetic complications
    102977108 (PIK3CB)
  09171 Infectious disease: bacterial
   05132 Salmonella infection
    102977108 (PIK3CB)
   05135 Yersinia infection
    102977108 (PIK3CB)
   05100 Bacterial invasion of epithelial cells
    102977108 (PIK3CB)
  09172 Infectious disease: viral
   05166 Human T-cell leukemia virus 1 infection
    102977108 (PIK3CB)
   05170 Human immunodeficiency virus 1 infection
    102977108 (PIK3CB)
   05161 Hepatitis B
    102977108 (PIK3CB)
   05160 Hepatitis C
    102977108 (PIK3CB)
   05171 Coronavirus disease - COVID-19
    102977108 (PIK3CB)
   05164 Influenza A
    102977108 (PIK3CB)
   05162 Measles
    102977108 (PIK3CB)
   05168 Herpes simplex virus 1 infection
    102977108 (PIK3CB)
   05163 Human cytomegalovirus infection
    102977108 (PIK3CB)
   05167 Kaposi sarcoma-associated herpesvirus infection
    102977108 (PIK3CB)
   05169 Epstein-Barr virus infection
    102977108 (PIK3CB)
   05165 Human papillomavirus infection
    102977108 (PIK3CB)
  09174 Infectious disease: parasitic
   05146 Amoebiasis
    102977108 (PIK3CB)
   05142 Chagas disease
    102977108 (PIK3CB)
  09176 Drug resistance: antineoplastic
   01521 EGFR tyrosine kinase inhibitor resistance
    102977108 (PIK3CB)
   01524 Platinum drug resistance
    102977108 (PIK3CB)
   01522 Endocrine resistance
    102977108 (PIK3CB)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04131 Membrane trafficking [BR:pcad04131]
    102977108 (PIK3CB)
Enzymes [BR:pcad01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.153  phosphatidylinositol-4,5-bisphosphate 3-kinase
     102977108 (PIK3CB)
Membrane trafficking [BR:pcad04131]
 Endocytosis
  Rab GTPases and associated proteins
   Rab associated proteins
    102977108 (PIK3CB)
SSDB
Motif
Pfam: PI3Ka PI3_PI4_kinase PI3K_rbd PI3K_p85B PI3K_C2 DUF4381 Tom37_C
Other DBs
NCBI-GeneID: 102977108
NCBI-ProteinID: XP_023987639
UniProt: A0A2Y9TH96
LinkDB
Position
1
AA seq 1070 aa
MCYRFIMPPAMADILDIWAVDSQIASDGSIPVDFLLPTGIYIQLEVPREATMSYIKQMLW
KQVHNYPMFNLLMEIDSYMFACVNQTAVYEELEDETRRLCDVRPFLPVLKLVTRSCDPGE
KLDSKIGVLIGRGLHEFDALKDPEVNEFRIKMRRFSEEKIQSLVGLSWMDWLKQTYPPEH
EPSIPENLEDKLYGGRLIVAVHFENCQDVFSFQVSPNMNPIKINELAIQKRLTIHGKEDE
VSPYDYVLQVSGRVEYVFGDHPLIQFQYIRNCVMNRTLPHFILVECCKIKKLYEQEMIAI
EAAINRNSSNLPLPLPPKKTRIISHVWENNNPFQIVLVKGNKLNTEETVKVHVRAGLFHG
TELLCKTVVSSEISGKNDHIWNEPLEFDINTCDLPRMARLCFAVYAVLDKVKTKKSTKAI
NPSKYQTIRKSGKVDYPVAWVNTMVFDFKGQLRSGDIILHSWSSFPDELEEMLNPMGTVQ
TNPYTENATALHIRFPENKKQPYYYPPFDKIIEKAAEIASSDSANVSSRGGKKFLAVLKE
ILDRDPLSQLCENEMDLIWTLRQDCRENFPQSLPKLLLSIKWNKLEDVAQLQALLQIWPK
LPPREALELLDFNYPDQYVREYAVGCLQQMSDEELSQYLLQLVQVLKYEPFLDCALSRFL
LERALANRRIGQFLFWHLRSEVHIPAVSVQFGVILEAYCRGSVGHMKALSKQVEALNKLK
TLNSLIKLNAMKLNRAKGKEAMHTCLKQNAYREALSDLQSPLNPCVILSELYIEKCKYMD
SKMKPLWLVYNNKVFGEDSVGVIFKNGDDLRQDMLTLQMLRLMDLLWKEAGLDLRMLPYG
CLATGDHSGLIEVVSTSETIADIQLNSSNVAAAAAFNKDALLNWLKEYNSGDDLDRAIEE
FTLSCAGYCVASYVLGIGDRHSDNIMVKKTGQLFHIDFGHILGNFKSKFGIKRERVPFIL
TYDFIHVIQQGKTGNTEKFGRFRQCCEDAYLILRRHGNLFITLFALMLTAGLPELTSVKD
IQYLKDSLALGKSEEEALKQFKQKFDEALRESWTTKVNWMAHTVRKDYRS
NT seq 3213 nt   +upstreamnt  +downstreamnt
atgtgctaccgcttcataatgcctcctgctatggcagacatccttgacatctgggcagtg
gattcacagatagcatctgatggctccatacctgtggatttccttttgcccactgggatt
tatatccagttggaggtacctcgggaagctaccatgtcctatattaaacagatgttatgg
aaacaagttcataattacccaatgtttaacctccttatggaaattgactcctatatgttt
gcatgtgtgaatcaaactgctgtatatgaggagcttgaagatgaaacaagaagactctgt
gatgttagaccttttcttccagttctcaaattagtgacaagaagttgtgacccaggagaa
aaattagactcaaaaattggagtccttataggaagaggtctgcatgaatttgatgccttg
aaggatcctgaggtgaatgaattccgaataaaaatgcgcagattcagtgaggaaaagatt
cagtcgcttgtgggattgtcttggatggattggctaaagcaaacctatccaccagagcat
gaaccatccattcctgaaaatttagaagataaactttacggaggaaggctcattgtggct
gttcattttgaaaattgtcaggatgtgtttagctttcaagtatctcctaatatgaatcct
atcaaaataaatgaattggcaatccaaaaacgtttgactattcatgggaaagaagatgaa
gttagcccctatgactatgtgttgcaagtcagtgggagagtagaatatgtgtttggtgat
cacccactaattcagttccagtatatccggaactgtgtaatgaataggaccttgccccat
tttatacttgtggaatgttgcaagatcaagaagctgtatgaacaggaaatgattgccata
gaggctgccataaatcgaaattcatctaaccttcctcttcctttaccaccaaagaaaact
cgaattatttctcatgtttgggaaaataacaaccctttccaaattgtcttggttaaggga
aataaacttaacacagaagaaactgtaaaagttcatgtcagggctggcctttttcatggt
accgaactcctgtgtaaaaccgtcgtaagctcagagatatcagggaaaaatgatcatatt
tggaacgaaccactggaatttgatatcaatacttgtgacctgccacgaatggctcgatta
tgttttgctgtttatgcagttttggataaagtgaaaacaaagaaatcaactaaagctatt
aatccctctaaatatcagaccatcaggaaatctggaaaagtggattatcctgtagcctgg
gtaaatacgatggtttttgactttaaaggacagttgagatctggagatataatattgcac
agctggtcttcatttcctgatgaacttgaagaaatgttgaatccaatgggaactgttcaa
acaaatccgtatactgaaaatgcaacagctttgcacatcagattcccagagaataaaaaa
caaccttattactatcctccctttgataagattattgaaaaggcagctgagattgcaagc
agtgatagtgctaatgtatcaagtcgaggtggaaagaagtttcttgctgtactgaaagaa
atcttggacagggatccgttgtctcaactgtgtgagaatgaaatggatcttatttggact
ttgcgacaagactgcagagagaatttcccacagtcattgccaaaattactgctgtcaatc
aagtggaataaacttgaggatgttgctcagcttcaggcactacttcagatttggcctaaa
ctgcccccccgggaggccctggagcttctagatttcaactatccagatcagtacgtgcga
gaatatgctgtgggctgtctgcaacagatgagtgatgaagaactctctcaatatctttta
cagttggtgcaagttttaaaatatgagccttttcttgattgtgccctctctagattccta
ctagaaagagcacttgctaatcggaggatagggcagtttttattttggcaccttaggtca
gaagtgcacattcctgctgtttcagtacaatttggtgtcatccttgaagcgtactgccgg
ggaagcgtaggtcacatgaaagcgctttccaagcaggttgaagcactcaataaattaaaa
actttaaatagtttaatcaaactgaatgcaatgaagctaaatagagccaaagggaaagaa
gcaatgcacacttgtttaaaacagaatgcttatcgggaagccctctctgacctgcaatca
cctctgaacccatgtgttatcctctcagaactctatattgaaaagtgtaaatacatggat
tccaaaatgaagcctttgtggctggtgtacaacaacaaggtgtttggtgaggattcagtt
ggagtgatttttaaaaatggtgatgatttacggcaggatatgttgacacttcaaatgctg
cgcttgatggatttactctggaaagaagctggtctggatcttaggatgctgccttatggc
tgtttagcaacaggagaccactctggcctcattgaagttgtgagcacctctgaaacaatt
gctgacattcagctgaacagtagcaatgtggctgcagcagcagccttcaacaaagatgcc
cttctgaactggcttaaagaatacaattctggggatgacctggaccgagccattgaggag
tttaccctgtcctgtgctggctactgtgtagcttcttatgtccttgggattggtgacaga
catagtgataacatcatggtcaaaaaaactggccagctcttccacattgactttggacat
attcttggaaatttcaagtctaaatttggcattaaaagggagagagtgccttttattctt
acctatgatttcattcatgtaattcaacaaggaaaaacaggaaacacggaaaagtttggc
cggttccgccagtgttgtgaggatgcatatctgattttgcgacggcatgggaatctcttc
atcacgctctttgcactgatgttgactgcagggcttcctgagctcacgtcagtcaaggat
atacagtaccttaaggactctcttgccttagggaagagtgaagaagaagcactcaagcaa
tttaagcaaaaatttgatgaggcactcagggaaagctggactactaaagtgaactggatg
gcccacacagttcggaaagactacagatcttaa

KEGG   Physeter catodon (sperm whale): 102978952
Entry
102978952         CDS       T06011                                 

Gene name
PIK3CD
Definition
(RefSeq) phosphatidylinositol 4,5-bisphosphate 3-kinase catalytic subunit delta isoform
  KO
K00922  phosphatidylinositol-4,5-bisphosphate 3-kinase catalytic subunit alpha/beta/delta [EC:2.7.1.153]
Organism
pcad  Physeter catodon (sperm whale)
Pathway
pcad00562  Inositol phosphate metabolism
pcad01100  Metabolic pathways
pcad01521  EGFR tyrosine kinase inhibitor resistance
pcad01522  Endocrine resistance
pcad01524  Platinum drug resistance
pcad04012  ErbB signaling pathway
pcad04014  Ras signaling pathway
pcad04015  Rap1 signaling pathway
pcad04024  cAMP signaling pathway
pcad04062  Chemokine signaling pathway
pcad04066  HIF-1 signaling pathway
pcad04068  FoxO signaling pathway
pcad04070  Phosphatidylinositol signaling system
pcad04071  Sphingolipid signaling pathway
pcad04072  Phospholipase D signaling pathway
pcad04140  Autophagy - animal
pcad04150  mTOR signaling pathway
pcad04151  PI3K-Akt signaling pathway
pcad04152  AMPK signaling pathway
pcad04210  Apoptosis
pcad04211  Longevity regulating pathway
pcad04213  Longevity regulating pathway - multiple species
pcad04218  Cellular senescence
pcad04360  Axon guidance
pcad04370  VEGF signaling pathway
pcad04380  Osteoclast differentiation
pcad04510  Focal adhesion
pcad04550  Signaling pathways regulating pluripotency of stem cells
pcad04611  Platelet activation
pcad04620  Toll-like receptor signaling pathway
pcad04625  C-type lectin receptor signaling pathway
pcad04630  JAK-STAT signaling pathway
pcad04650  Natural killer cell mediated cytotoxicity
pcad04660  T cell receptor signaling pathway
pcad04662  B cell receptor signaling pathway
pcad04664  Fc epsilon RI signaling pathway
pcad04666  Fc gamma R-mediated phagocytosis
pcad04668  TNF signaling pathway
pcad04670  Leukocyte transendothelial migration
pcad04722  Neurotrophin signaling pathway
pcad04725  Cholinergic synapse
pcad04750  Inflammatory mediator regulation of TRP channels
pcad04810  Regulation of actin cytoskeleton
pcad04910  Insulin signaling pathway
pcad04914  Progesterone-mediated oocyte maturation
pcad04915  Estrogen signaling pathway
pcad04917  Prolactin signaling pathway
pcad04919  Thyroid hormone signaling pathway
pcad04923  Regulation of lipolysis in adipocytes
pcad04926  Relaxin signaling pathway
pcad04929  GnRH secretion
pcad04930  Type II diabetes mellitus
pcad04931  Insulin resistance
pcad04932  Non-alcoholic fatty liver disease
pcad04933  AGE-RAGE signaling pathway in diabetic complications
pcad04935  Growth hormone synthesis, secretion and action
pcad04960  Aldosterone-regulated sodium reabsorption
pcad04973  Carbohydrate digestion and absorption
pcad05010  Alzheimer disease
pcad05017  Spinocerebellar ataxia
pcad05020  Prion disease
pcad05100  Bacterial invasion of epithelial cells
pcad05132  Salmonella infection
pcad05135  Yersinia infection
pcad05142  Chagas disease
pcad05146  Amoebiasis
pcad05160  Hepatitis C
pcad05161  Hepatitis B
pcad05162  Measles
pcad05163  Human cytomegalovirus infection
pcad05164  Influenza A
pcad05165  Human papillomavirus infection
pcad05166  Human T-cell leukemia virus 1 infection
pcad05167  Kaposi sarcoma-associated herpesvirus infection
pcad05168  Herpes simplex virus 1 infection
pcad05169  Epstein-Barr virus infection
pcad05170  Human immunodeficiency virus 1 infection
pcad05171  Coronavirus disease - COVID-19
pcad05200  Pathways in cancer
pcad05203  Viral carcinogenesis
pcad05205  Proteoglycans in cancer
pcad05206  MicroRNAs in cancer
pcad05210  Colorectal cancer
pcad05211  Renal cell carcinoma
pcad05212  Pancreatic cancer
pcad05213  Endometrial cancer
pcad05214  Glioma
pcad05215  Prostate cancer
pcad05218  Melanoma
pcad05220  Chronic myeloid leukemia
pcad05221  Acute myeloid leukemia
pcad05222  Small cell lung cancer
pcad05223  Non-small cell lung cancer
pcad05224  Breast cancer
pcad05225  Hepatocellular carcinoma
pcad05226  Gastric cancer
pcad05230  Central carbon metabolism in cancer
pcad05231  Choline metabolism in cancer
pcad05235  PD-L1 expression and PD-1 checkpoint pathway in cancer
pcad05418  Fluid shear stress and atherosclerosis
Brite
KEGG Orthology (KO) [BR:pcad00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00562 Inositol phosphate metabolism
    102978952 (PIK3CD)
 09130 Environmental Information Processing
  09132 Signal transduction
   04012 ErbB signaling pathway
    102978952 (PIK3CD)
   04014 Ras signaling pathway
    102978952 (PIK3CD)
   04015 Rap1 signaling pathway
    102978952 (PIK3CD)
   04370 VEGF signaling pathway
    102978952 (PIK3CD)
   04630 JAK-STAT signaling pathway
    102978952 (PIK3CD)
   04668 TNF signaling pathway
    102978952 (PIK3CD)
   04066 HIF-1 signaling pathway
    102978952 (PIK3CD)
   04068 FoxO signaling pathway
    102978952 (PIK3CD)
   04070 Phosphatidylinositol signaling system
    102978952 (PIK3CD)
   04072 Phospholipase D signaling pathway
    102978952 (PIK3CD)
   04071 Sphingolipid signaling pathway
    102978952 (PIK3CD)
   04024 cAMP signaling pathway
    102978952 (PIK3CD)
   04151 PI3K-Akt signaling pathway
    102978952 (PIK3CD)
   04152 AMPK signaling pathway
    102978952 (PIK3CD)
   04150 mTOR signaling pathway
    102978952 (PIK3CD)
 09140 Cellular Processes
  09141 Transport and catabolism
   04140 Autophagy - animal
    102978952 (PIK3CD)
  09143 Cell growth and death
   04210 Apoptosis
    102978952 (PIK3CD)
   04218 Cellular senescence
    102978952 (PIK3CD)
  09144 Cellular community - eukaryotes
   04510 Focal adhesion
    102978952 (PIK3CD)
   04550 Signaling pathways regulating pluripotency of stem cells
    102978952 (PIK3CD)
  09142 Cell motility
   04810 Regulation of actin cytoskeleton
    102978952 (PIK3CD)
 09150 Organismal Systems
  09151 Immune system
   04611 Platelet activation
    102978952 (PIK3CD)
   04620 Toll-like receptor signaling pathway
    102978952 (PIK3CD)
   04625 C-type lectin receptor signaling pathway
    102978952 (PIK3CD)
   04650 Natural killer cell mediated cytotoxicity
    102978952 (PIK3CD)
   04660 T cell receptor signaling pathway
    102978952 (PIK3CD)
   04662 B cell receptor signaling pathway
    102978952 (PIK3CD)
   04664 Fc epsilon RI signaling pathway
    102978952 (PIK3CD)
   04666 Fc gamma R-mediated phagocytosis
    102978952 (PIK3CD)
   04670 Leukocyte transendothelial migration
    102978952 (PIK3CD)
   04062 Chemokine signaling pathway
    102978952 (PIK3CD)
  09152 Endocrine system
   04910 Insulin signaling pathway
    102978952 (PIK3CD)
   04923 Regulation of lipolysis in adipocytes
    102978952 (PIK3CD)
   04929 GnRH secretion
    102978952 (PIK3CD)
   04915 Estrogen signaling pathway
    102978952 (PIK3CD)
   04914 Progesterone-mediated oocyte maturation
    102978952 (PIK3CD)
   04917 Prolactin signaling pathway
    102978952 (PIK3CD)
   04926 Relaxin signaling pathway
    102978952 (PIK3CD)
   04935 Growth hormone synthesis, secretion and action
    102978952 (PIK3CD)
   04919 Thyroid hormone signaling pathway
    102978952 (PIK3CD)
  09154 Digestive system
   04973 Carbohydrate digestion and absorption
    102978952 (PIK3CD)
  09155 Excretory system
   04960 Aldosterone-regulated sodium reabsorption
    102978952 (PIK3CD)
  09156 Nervous system
   04725 Cholinergic synapse
    102978952 (PIK3CD)
   04722 Neurotrophin signaling pathway
    102978952 (PIK3CD)
  09157 Sensory system
   04750 Inflammatory mediator regulation of TRP channels
    102978952 (PIK3CD)
  09158 Development and regeneration
   04360 Axon guidance
    102978952 (PIK3CD)
   04380 Osteoclast differentiation
    102978952 (PIK3CD)
  09149 Aging
   04211 Longevity regulating pathway
    102978952 (PIK3CD)
   04213 Longevity regulating pathway - multiple species
    102978952 (PIK3CD)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    102978952 (PIK3CD)
   05206 MicroRNAs in cancer
    102978952 (PIK3CD)
   05205 Proteoglycans in cancer
    102978952 (PIK3CD)
   05203 Viral carcinogenesis
    102978952 (PIK3CD)
   05230 Central carbon metabolism in cancer
    102978952 (PIK3CD)
   05231 Choline metabolism in cancer
    102978952 (PIK3CD)
   05235 PD-L1 expression and PD-1 checkpoint pathway in cancer
    102978952 (PIK3CD)
  09162 Cancer: specific types
   05210 Colorectal cancer
    102978952 (PIK3CD)
   05212 Pancreatic cancer
    102978952 (PIK3CD)
   05225 Hepatocellular carcinoma
    102978952 (PIK3CD)
   05226 Gastric cancer
    102978952 (PIK3CD)
   05214 Glioma
    102978952 (PIK3CD)
   05221 Acute myeloid leukemia
    102978952 (PIK3CD)
   05220 Chronic myeloid leukemia
    102978952 (PIK3CD)
   05218 Melanoma
    102978952 (PIK3CD)
   05211 Renal cell carcinoma
    102978952 (PIK3CD)
   05215 Prostate cancer
    102978952 (PIK3CD)
   05213 Endometrial cancer
    102978952 (PIK3CD)
   05224 Breast cancer
    102978952 (PIK3CD)
   05222 Small cell lung cancer
    102978952 (PIK3CD)
   05223 Non-small cell lung cancer
    102978952 (PIK3CD)
  09164 Neurodegenerative disease
   05010 Alzheimer disease
    102978952 (PIK3CD)
   05017 Spinocerebellar ataxia
    102978952 (PIK3CD)
   05020 Prion disease
    102978952 (PIK3CD)
  09166 Cardiovascular disease
   05418 Fluid shear stress and atherosclerosis
    102978952 (PIK3CD)
  09167 Endocrine and metabolic disease
   04930 Type II diabetes mellitus
    102978952 (PIK3CD)
   04932 Non-alcoholic fatty liver disease
    102978952 (PIK3CD)
   04931 Insulin resistance
    102978952 (PIK3CD)
   04933 AGE-RAGE signaling pathway in diabetic complications
    102978952 (PIK3CD)
  09171 Infectious disease: bacterial
   05132 Salmonella infection
    102978952 (PIK3CD)
   05135 Yersinia infection
    102978952 (PIK3CD)
   05100 Bacterial invasion of epithelial cells
    102978952 (PIK3CD)
  09172 Infectious disease: viral
   05166 Human T-cell leukemia virus 1 infection
    102978952 (PIK3CD)
   05170 Human immunodeficiency virus 1 infection
    102978952 (PIK3CD)
   05161 Hepatitis B
    102978952 (PIK3CD)
   05160 Hepatitis C
    102978952 (PIK3CD)
   05171 Coronavirus disease - COVID-19
    102978952 (PIK3CD)
   05164 Influenza A
    102978952 (PIK3CD)
   05162 Measles
    102978952 (PIK3CD)
   05168 Herpes simplex virus 1 infection
    102978952 (PIK3CD)
   05163 Human cytomegalovirus infection
    102978952 (PIK3CD)
   05167 Kaposi sarcoma-associated herpesvirus infection
    102978952 (PIK3CD)
   05169 Epstein-Barr virus infection
    102978952 (PIK3CD)
   05165 Human papillomavirus infection
    102978952 (PIK3CD)
  09174 Infectious disease: parasitic
   05146 Amoebiasis
    102978952 (PIK3CD)
   05142 Chagas disease
    102978952 (PIK3CD)
  09176 Drug resistance: antineoplastic
   01521 EGFR tyrosine kinase inhibitor resistance
    102978952 (PIK3CD)
   01524 Platinum drug resistance
    102978952 (PIK3CD)
   01522 Endocrine resistance
    102978952 (PIK3CD)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04131 Membrane trafficking [BR:pcad04131]
    102978952 (PIK3CD)
Enzymes [BR:pcad01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.153  phosphatidylinositol-4,5-bisphosphate 3-kinase
     102978952 (PIK3CD)
Membrane trafficking [BR:pcad04131]
 Endocytosis
  Rab GTPases and associated proteins
   Rab associated proteins
    102978952 (PIK3CD)
SSDB
Motif
Pfam: PI3_PI4_kinase PI3Ka PI3K_p85B PI3K_rbd PI3K_C2 DUF4135
Other DBs
NCBI-GeneID: 102978952
NCBI-ProteinID: XP_023981521
UniProt: A0A2Y9SS64
LinkDB
Position
3
AA seq 1044 aa
MPPGVDCPMEFWTKEENQNVAVDFLLPTGVYLNFPVSRNANLSTIKKVLWRRAQYEPLFH
MLSDPEAYVFTCVNQTAEQQELEDEQRRLCDIQPFLPVLRLVAREGDRVKKLINSQISLL
IGKGLHEFDSLQDPEVNDFRAKMRQFCEEAAAHRQQLGWEAWLQYSFPLQLEPSARSWGP
GTLRVPSRALLVNVKFEGSEESFTFQVSTKDVPLALMACALRKKATVFRQPLVEQPEDYT
LQVNGKHEYLYGSYPLCQFQYICSCLHSGLTPHLTMVHSSSILAMRDEQSNPAPQVQKPR
AKPPPIPLKKPALVSLWSLEQPFCIELIQGSKVNADERMKLVVQAGLFHGNETLCKTVSS
SEVSVCSEPVWKQRLEFDINICDLPRMARLCFALYAVIEKAKKARSTKKKSKKADCPIAW
ANLMLFDYKDQLKTGERCLYMWPSVPDEKGELLNPCGTVRSNPNTESAAALVIFLPEAAP
HPVYYPALDKILELGRHGEHGRFTEEEQLQLREVLERRGSGELYEHEKDLVWKMRHEVQE
HFPEALARLLLVTKWNKHEDVAQMLYLLCSWPELPVLSALELLDFSFPDRHVGSFAIKSL
RKLTDDELFQYLLQLVQVLKYESYLDCELTKFLLDRALANRKIGHFLFWHLRSEMHVPSV
ALRFGLIMEAYCRGSTHHMKVLMKQGEALSKLKALNDVVKVSSQKTTKPQTKELMHLCLR
QETYLEALSRLQSPLDPSTLLAEVCVEQCTFMDSKMKPLWVVYSNEEAGSDGTVGIIFKN
GDDLRQDMLTLQMIQLMDVLWKQEGLDLRMTPYGCLSTGDHTGLIEVVLHSDTIANIQLN
KSNMAATAAFNKDALLNWLKSKNPGEALDRAIEEFTLSCAGYCVATYVLGIGDRHSDNIM
IRENGQLFHIDFGHFLGNFKTKFGINRERVPFILTYDFVHVIQQGKTNNSEKFERFRGYC
ERAYTILRRHGLLFLHLFALMRAAGLPELSCSKDIQYLKDSLALGKTEEEALKHFRVKFN
EALRESWKTKVNWLAHNVSKDNRQ
NT seq 3135 nt   +upstreamnt  +downstreamnt
atgccccccggggttgactgccccatggaattctggaccaaggaggagaatcagaacgtg
gccgttgatttcttgctgcccacgggggtctatctgaacttccctgtgtcccgaaatgcc
aacctcagcaccatcaagaaggtgttgtggcgccgagcccagtatgagccgctcttccac
atgctcagcgaccccgaggcctacgtgttcacctgcgtcaaccagaccgcggagcagcaa
gagctggaggacgagcagcggcggctgtgcgacatccagcccttcctgcccgtcctgcgc
ctggtggcccgcgagggtgaccgggtgaagaagctcatcaactcgcagatcagcttgctc
atcggcaaaggcctccacgagtttgactccttgcaagacccggaggtgaatgacttccga
gccaagatgcgccagttctgcgaggaggcggccgcgcaccgacagcagctgggctgggag
gcctggctgcagtacagcttccccctgcagctggagccctcggcgcggagctgggggccg
ggcaccctgcgcgtccccagccgggccctgctcgtcaacgtcaagttcgagggcagcgag
gagagcttcaccttccaggtgtccaccaaggatgtgcccctggcactgatggcctgcgcg
ctccggaagaaggccacggtgttccggcagccgctggtggaacagcccgaggactacacg
ctgcaggtgaacgggaagcacgagtacctgtacggcagctaccccctctgccagttccag
tacatctgcagctgcctgcacagcgggctgaccccccacctgaccatggtgcactcctct
tccatcctcgccatgcgggacgagcagagcaaccccgccccccaagtccaaaagccccgc
gccaaaccgccccccattcctctgaagaagcctgccttggtgtccctgtggtccctggag
cagcctttctgcatcgagctgatccagggcagcaaagtgaatgctgatgagcggatgaag
ctggtggtgcaggccggcctcttccacggcaacgagacgctgtgcaagacggtgtccagc
tcggaggtgagcgtgtgctcggagcctgtgtggaagcagcggctggagttcgacatcaac
atctgcgacctaccgcgcatggcccgcctctgctttgcgctctacgccgtgatcgagaag
gccaagaaggcgcgctccaccaagaagaagtccaagaaggcggactgccccatcgcctgg
gccaacctcatgctgtttgattacaaggaccagctcaagaccggcgagcgctgcctctac
atgtggccctccgtcccagacgagaaaggggagctactgaacccctgtgggaccgtgcgg
agtaaccccaacactgagagcgcggccgccctggtcatctttctccctgaggcggccccc
caccctgtatactaccctgccctggacaagatcctagagctggggcggcatggggagcac
gggcgcttcacggaggaggagcagctgcagctgcgggaggtcctggagcgccgggggtct
ggggagctgtacgagcacgagaaggacctggtgtggaagatgcggcacgaggtccaggag
cacttccccgaggcgctggcccggttgctgctggtcaccaagtggaacaagcacgaggac
gtggcccagatgctctacctgctgtgctcctggcccgagctgcccgtcctgagtgccctg
gagctgctggacttcagcttccccgaccgccacgtgggctcctttgccatcaagtccctg
cggaaactgacggacgacgagcttttccagtacctgctgcagctggtgcaggtgctcaag
tacgagtcctacctcgactgcgagctgaccaaattcctgctggaccgggccctggccaat
cgcaagatcggccacttcctcttctggcacctgcgctccgagatgcacgtgccctcggtg
gccctgcgcttcggcctcatcatggaggcctactgcaggggcagcacccatcacatgaag
gtgctgatgaagcagggggaagcgctgagcaagctgaaggccctgaacgacgtcgtcaaa
gtgagctcccagaagaccaccaagccccagaccaaggagctgatgcacctgtgcttgcgc
caggagacctacctggaggccctctcccgcctgcagtccccgctcgaccccagcaccctg
ctggctgaagtctgcgtggagcagtgcaccttcatggactccaagatgaagcccctgtgg
gtcgtgtacagcaatgaggaggcgggcagcgatggcaccgtgggcatcatctttaagaac
ggggacgacctccgccaggacatgctgaccctgcagatgatccagctgatggacgttctg
tggaagcaggagggcttggacctgaggatgaccccttacggctgcctctccactggggac
cacacaggcctcatcgaggtggtgcttcactcagacaccatcgccaacatccagctgaac
aagagcaacatggcggccacggctgccttcaacaaggatgctctgctcaactggctcaag
tccaagaaccctggggaggccctggatcgagccatcgaggaattcaccctctcctgcgcc
ggctactgtgtggccacgtacgtgctgggcatcggtgatcggcacagcgacaacatcatg
atccgagagaacgggcagctgttccacattgatttcggccactttctggggaatttcaag
accaagtttggaatcaaccgtgagcgagtcccgttcatcctcacctatgactttgtccac
gtgatccagcaggggaagacgaataatagtgagaaatttgaaaggttccggggctactgt
gaaagggcctacaccatcctgcggcgccacgggctgctctttctccacctctttgccttg
atgcgggcggcaggcctgcctgagctcagctgctccaaagacatccagtacctcaaggat
tctctggcactggggaagacggaggaggaggctctaaagcacttccgggtgaagtttaac
gaagccctccgggagagctggaaaaccaaagtgaactggctggcccacaacgtgtccaaa
gataacaggcaatag

KEGG   Physeter catodon (sperm whale): 102986098
Entry
102986098         CDS       T06011                                 

Gene name
PIK3CA
Definition
(RefSeq) phosphatidylinositol 4,5-bisphosphate 3-kinase catalytic subunit alpha isoform
  KO
K00922  phosphatidylinositol-4,5-bisphosphate 3-kinase catalytic subunit alpha/beta/delta [EC:2.7.1.153]
Organism
pcad  Physeter catodon (sperm whale)
Pathway
pcad00562  Inositol phosphate metabolism
pcad01100  Metabolic pathways
pcad01521  EGFR tyrosine kinase inhibitor resistance
pcad01522  Endocrine resistance
pcad01524  Platinum drug resistance
pcad04012  ErbB signaling pathway
pcad04014  Ras signaling pathway
pcad04015  Rap1 signaling pathway
pcad04024  cAMP signaling pathway
pcad04062  Chemokine signaling pathway
pcad04066  HIF-1 signaling pathway
pcad04068  FoxO signaling pathway
pcad04070  Phosphatidylinositol signaling system
pcad04071  Sphingolipid signaling pathway
pcad04072  Phospholipase D signaling pathway
pcad04140  Autophagy - animal
pcad04150  mTOR signaling pathway
pcad04151  PI3K-Akt signaling pathway
pcad04152  AMPK signaling pathway
pcad04210  Apoptosis
pcad04211  Longevity regulating pathway
pcad04213  Longevity regulating pathway - multiple species
pcad04218  Cellular senescence
pcad04360  Axon guidance
pcad04370  VEGF signaling pathway
pcad04380  Osteoclast differentiation
pcad04510  Focal adhesion
pcad04550  Signaling pathways regulating pluripotency of stem cells
pcad04611  Platelet activation
pcad04620  Toll-like receptor signaling pathway
pcad04625  C-type lectin receptor signaling pathway
pcad04630  JAK-STAT signaling pathway
pcad04650  Natural killer cell mediated cytotoxicity
pcad04660  T cell receptor signaling pathway
pcad04662  B cell receptor signaling pathway
pcad04664  Fc epsilon RI signaling pathway
pcad04666  Fc gamma R-mediated phagocytosis
pcad04668  TNF signaling pathway
pcad04670  Leukocyte transendothelial migration
pcad04722  Neurotrophin signaling pathway
pcad04725  Cholinergic synapse
pcad04750  Inflammatory mediator regulation of TRP channels
pcad04810  Regulation of actin cytoskeleton
pcad04910  Insulin signaling pathway
pcad04914  Progesterone-mediated oocyte maturation
pcad04915  Estrogen signaling pathway
pcad04917  Prolactin signaling pathway
pcad04919  Thyroid hormone signaling pathway
pcad04923  Regulation of lipolysis in adipocytes
pcad04926  Relaxin signaling pathway
pcad04929  GnRH secretion
pcad04930  Type II diabetes mellitus
pcad04931  Insulin resistance
pcad04932  Non-alcoholic fatty liver disease
pcad04933  AGE-RAGE signaling pathway in diabetic complications
pcad04935  Growth hormone synthesis, secretion and action
pcad04960  Aldosterone-regulated sodium reabsorption
pcad04973  Carbohydrate digestion and absorption
pcad05010  Alzheimer disease
pcad05017  Spinocerebellar ataxia
pcad05020  Prion disease
pcad05100  Bacterial invasion of epithelial cells
pcad05132  Salmonella infection
pcad05135  Yersinia infection
pcad05142  Chagas disease
pcad05146  Amoebiasis
pcad05160  Hepatitis C
pcad05161  Hepatitis B
pcad05162  Measles
pcad05163  Human cytomegalovirus infection
pcad05164  Influenza A
pcad05165  Human papillomavirus infection
pcad05166  Human T-cell leukemia virus 1 infection
pcad05167  Kaposi sarcoma-associated herpesvirus infection
pcad05168  Herpes simplex virus 1 infection
pcad05169  Epstein-Barr virus infection
pcad05170  Human immunodeficiency virus 1 infection
pcad05171  Coronavirus disease - COVID-19
pcad05200  Pathways in cancer
pcad05203  Viral carcinogenesis
pcad05205  Proteoglycans in cancer
pcad05206  MicroRNAs in cancer
pcad05210  Colorectal cancer
pcad05211  Renal cell carcinoma
pcad05212  Pancreatic cancer
pcad05213  Endometrial cancer
pcad05214  Glioma
pcad05215  Prostate cancer
pcad05218  Melanoma
pcad05220  Chronic myeloid leukemia
pcad05221  Acute myeloid leukemia
pcad05222  Small cell lung cancer
pcad05223  Non-small cell lung cancer
pcad05224  Breast cancer
pcad05225  Hepatocellular carcinoma
pcad05226  Gastric cancer
pcad05230  Central carbon metabolism in cancer
pcad05231  Choline metabolism in cancer
pcad05235  PD-L1 expression and PD-1 checkpoint pathway in cancer
pcad05418  Fluid shear stress and atherosclerosis
Brite
KEGG Orthology (KO) [BR:pcad00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00562 Inositol phosphate metabolism
    102986098 (PIK3CA)
 09130 Environmental Information Processing
  09132 Signal transduction
   04012 ErbB signaling pathway
    102986098 (PIK3CA)
   04014 Ras signaling pathway
    102986098 (PIK3CA)
   04015 Rap1 signaling pathway
    102986098 (PIK3CA)
   04370 VEGF signaling pathway
    102986098 (PIK3CA)
   04630 JAK-STAT signaling pathway
    102986098 (PIK3CA)
   04668 TNF signaling pathway
    102986098 (PIK3CA)
   04066 HIF-1 signaling pathway
    102986098 (PIK3CA)
   04068 FoxO signaling pathway
    102986098 (PIK3CA)
   04070 Phosphatidylinositol signaling system
    102986098 (PIK3CA)
   04072 Phospholipase D signaling pathway
    102986098 (PIK3CA)
   04071 Sphingolipid signaling pathway
    102986098 (PIK3CA)
   04024 cAMP signaling pathway
    102986098 (PIK3CA)
   04151 PI3K-Akt signaling pathway
    102986098 (PIK3CA)
   04152 AMPK signaling pathway
    102986098 (PIK3CA)
   04150 mTOR signaling pathway
    102986098 (PIK3CA)
 09140 Cellular Processes
  09141 Transport and catabolism
   04140 Autophagy - animal
    102986098 (PIK3CA)
  09143 Cell growth and death
   04210 Apoptosis
    102986098 (PIK3CA)
   04218 Cellular senescence
    102986098 (PIK3CA)
  09144 Cellular community - eukaryotes
   04510 Focal adhesion
    102986098 (PIK3CA)
   04550 Signaling pathways regulating pluripotency of stem cells
    102986098 (PIK3CA)
  09142 Cell motility
   04810 Regulation of actin cytoskeleton
    102986098 (PIK3CA)
 09150 Organismal Systems
  09151 Immune system
   04611 Platelet activation
    102986098 (PIK3CA)
   04620 Toll-like receptor signaling pathway
    102986098 (PIK3CA)
   04625 C-type lectin receptor signaling pathway
    102986098 (PIK3CA)
   04650 Natural killer cell mediated cytotoxicity
    102986098 (PIK3CA)
   04660 T cell receptor signaling pathway
    102986098 (PIK3CA)
   04662 B cell receptor signaling pathway
    102986098 (PIK3CA)
   04664 Fc epsilon RI signaling pathway
    102986098 (PIK3CA)
   04666 Fc gamma R-mediated phagocytosis
    102986098 (PIK3CA)
   04670 Leukocyte transendothelial migration
    102986098 (PIK3CA)
   04062 Chemokine signaling pathway
    102986098 (PIK3CA)
  09152 Endocrine system
   04910 Insulin signaling pathway
    102986098 (PIK3CA)
   04923 Regulation of lipolysis in adipocytes
    102986098 (PIK3CA)
   04929 GnRH secretion
    102986098 (PIK3CA)
   04915 Estrogen signaling pathway
    102986098 (PIK3CA)
   04914 Progesterone-mediated oocyte maturation
    102986098 (PIK3CA)
   04917 Prolactin signaling pathway
    102986098 (PIK3CA)
   04926 Relaxin signaling pathway
    102986098 (PIK3CA)
   04935 Growth hormone synthesis, secretion and action
    102986098 (PIK3CA)
   04919 Thyroid hormone signaling pathway
    102986098 (PIK3CA)
  09154 Digestive system
   04973 Carbohydrate digestion and absorption
    102986098 (PIK3CA)
  09155 Excretory system
   04960 Aldosterone-regulated sodium reabsorption
    102986098 (PIK3CA)
  09156 Nervous system
   04725 Cholinergic synapse
    102986098 (PIK3CA)
   04722 Neurotrophin signaling pathway
    102986098 (PIK3CA)
  09157 Sensory system
   04750 Inflammatory mediator regulation of TRP channels
    102986098 (PIK3CA)
  09158 Development and regeneration
   04360 Axon guidance
    102986098 (PIK3CA)
   04380 Osteoclast differentiation
    102986098 (PIK3CA)
  09149 Aging
   04211 Longevity regulating pathway
    102986098 (PIK3CA)
   04213 Longevity regulating pathway - multiple species
    102986098 (PIK3CA)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    102986098 (PIK3CA)
   05206 MicroRNAs in cancer
    102986098 (PIK3CA)
   05205 Proteoglycans in cancer
    102986098 (PIK3CA)
   05203 Viral carcinogenesis
    102986098 (PIK3CA)
   05230 Central carbon metabolism in cancer
    102986098 (PIK3CA)
   05231 Choline metabolism in cancer
    102986098 (PIK3CA)
   05235 PD-L1 expression and PD-1 checkpoint pathway in cancer
    102986098 (PIK3CA)
  09162 Cancer: specific types
   05210 Colorectal cancer
    102986098 (PIK3CA)
   05212 Pancreatic cancer
    102986098 (PIK3CA)
   05225 Hepatocellular carcinoma
    102986098 (PIK3CA)
   05226 Gastric cancer
    102986098 (PIK3CA)
   05214 Glioma
    102986098 (PIK3CA)
   05221 Acute myeloid leukemia
    102986098 (PIK3CA)
   05220 Chronic myeloid leukemia
    102986098 (PIK3CA)
   05218 Melanoma
    102986098 (PIK3CA)
   05211 Renal cell carcinoma
    102986098 (PIK3CA)
   05215 Prostate cancer
    102986098 (PIK3CA)
   05213 Endometrial cancer
    102986098 (PIK3CA)
   05224 Breast cancer
    102986098 (PIK3CA)
   05222 Small cell lung cancer
    102986098 (PIK3CA)
   05223 Non-small cell lung cancer
    102986098 (PIK3CA)
  09164 Neurodegenerative disease
   05010 Alzheimer disease
    102986098 (PIK3CA)
   05017 Spinocerebellar ataxia
    102986098 (PIK3CA)
   05020 Prion disease
    102986098 (PIK3CA)
  09166 Cardiovascular disease
   05418 Fluid shear stress and atherosclerosis
    102986098 (PIK3CA)
  09167 Endocrine and metabolic disease
   04930 Type II diabetes mellitus
    102986098 (PIK3CA)
   04932 Non-alcoholic fatty liver disease
    102986098 (PIK3CA)
   04931 Insulin resistance
    102986098 (PIK3CA)
   04933 AGE-RAGE signaling pathway in diabetic complications
    102986098 (PIK3CA)
  09171 Infectious disease: bacterial
   05132 Salmonella infection
    102986098 (PIK3CA)
   05135 Yersinia infection
    102986098 (PIK3CA)
   05100 Bacterial invasion of epithelial cells
    102986098 (PIK3CA)
  09172 Infectious disease: viral
   05166 Human T-cell leukemia virus 1 infection
    102986098 (PIK3CA)
   05170 Human immunodeficiency virus 1 infection
    102986098 (PIK3CA)
   05161 Hepatitis B
    102986098 (PIK3CA)
   05160 Hepatitis C
    102986098 (PIK3CA)
   05171 Coronavirus disease - COVID-19
    102986098 (PIK3CA)
   05164 Influenza A
    102986098 (PIK3CA)
   05162 Measles
    102986098 (PIK3CA)
   05168 Herpes simplex virus 1 infection
    102986098 (PIK3CA)
   05163 Human cytomegalovirus infection
    102986098 (PIK3CA)
   05167 Kaposi sarcoma-associated herpesvirus infection
    102986098 (PIK3CA)
   05169 Epstein-Barr virus infection
    102986098 (PIK3CA)
   05165 Human papillomavirus infection
    102986098 (PIK3CA)
  09174 Infectious disease: parasitic
   05146 Amoebiasis
    102986098 (PIK3CA)
   05142 Chagas disease
    102986098 (PIK3CA)
  09176 Drug resistance: antineoplastic
   01521 EGFR tyrosine kinase inhibitor resistance
    102986098 (PIK3CA)
   01524 Platinum drug resistance
    102986098 (PIK3CA)
   01522 Endocrine resistance
    102986098 (PIK3CA)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04131 Membrane trafficking [BR:pcad04131]
    102986098 (PIK3CA)
Enzymes [BR:pcad01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.153  phosphatidylinositol-4,5-bisphosphate 3-kinase
     102986098 (PIK3CA)
Membrane trafficking [BR:pcad04131]
 Endocytosis
  Rab GTPases and associated proteins
   Rab associated proteins
    102986098 (PIK3CA)
SSDB
Motif
Pfam: PI3Ka PI3_PI4_kinase PI3K_rbd PI3K_C2 PI3K_p85B DUF2321 ASC Ribosomal_S15
Other DBs
NCBI-GeneID: 102986098
NCBI-ProteinID: XP_028347198
UniProt: A0A455BH09
LinkDB
Position
1
AA seq 1068 aa
MPPRPSSGELWGIHLMPPRILVECLLPNGMIVTLECLREATLITIKHELFKEARKYPLHQ
LLQDESSYIFVSVTQEAEREEFFDETRRLCDLRLFQPFLKVIEPVGNREEKILNREIGFA
IGMPVCEFDMVKDPEVQDFRRNILNVCKEAVDLRDLNSPHSRAMYVYPPNVESSPELPKH
IYNKLDKGQIIVVIWVIVSPNNDKQKYTLKINHDCVPEQVIAEAIRKKTRSMLLSSEQLK
LCVLEYQGKYILKVCGCDEYFLEKYPLSQYKYIRSCIMLGRMPNLMLMAKESLYSQLPMD
CFTMPSYSRRISTATPYMNGETSTKSLWVINSALRIKILCATYVNVNIRDIDKIYVRTGI
YHGGEPLCDNVNTQRVPCSNPRWNEWLNYDIYIPDLPRAARLCLSICSVKGRKGAKEEHC
PLAWGNINLFDYTDTLVSGKMALNLWPVPHGLEDLLNPIGVTGSNPNKETPCLELEFDWF
SSVVKFPDMSVIEEHANWSVSREAGFSYSHAGLSNRLARDNELRENDKEQLRAICTRDPL
SEITEQEKDFLWSHRHYCVTIPEILPKLLLSVKWNSRDEVAQMYCLVKDWPPIKPEQAME
LLDCNYPDPMVRGFAVRCLEKYLTDDKLSQYLIQLVQVLKYEQYLDNLLVRFLLKKALTN
QRIGHFFFWHLKSEMHNKTVSQRFGLLLESYCRACGMYLKHLNRQVEAMEKLINLTDILK
QEKKDETQKVQMKFLVEQMRRPDFMDALQGFLSPLNPAHQLGNLRLEECRIMSSAKRPLW
LNWENPDIMSELLFQNNEIIFKNGDDLRQDMLTLQIIRIMENIWQNQGLDLRMLPYGCLS
IGDCVGLIEVVRNSHTIMQIQCKGGLKGALQFNSHTLHQWLKDKNKGEIYDAAIDLFTRS
CAGYCVATFILGIGDRHNSNIMVKDDGQLFHIDFGHFLDHKKKKFGYKRERVPFVLTQDF
LIVISKGAQECTKTREFERFQEMCYKAYLAIRQHANLFINLFSMMLGSGMPELQSFDDIA
YIRKTLALDKTEQEALEYFMKQMNDAHHGGWTTKMDWIFHTIKQHALN
NT seq 3207 nt   +upstreamnt  +downstreamnt
atgcctccaagaccatcatcaggtgaactgtggggcatccacttgatgcccccaagaatc
ctagtagaatgtttactaccaaatgggatgatagtgactttagaatgcctccgtgaggct
acattaataactataaagcatgaactatttaaagaagcgagaaaataccctctccatcaa
cttcttcaagatgaatcttcttacattttcgtaagtgttacccaagaagcagaaagggaa
gaattttttgatgaaacaagacgactttgtgaccttcggctttttcaaccctttttaaaa
gtaattgaaccagtaggcaaccgtgaagaaaagatcctcaatcgagaaattggttttgct
attggcatgccagtgtgtgaattcgatatggttaaagatccagaagtacaggacttccga
agaaatattctgaatgtttgtaaagaagctgtggatcttagggatctcaattcaccgcat
agtagagcaatgtatgtctatcctccaaacgtagaatcttcaccagaactgccaaagcac
atatataataaattggataaagggcaaataatagtggtgatttgggtaatagtttctcca
aataatgacaagcagaagtatactctgaaaatcaaccatgactgtgtgccagaacaagta
attgctgaagcaatcaggaaaaaaactcgaagtatgttgctatcatctgaacaactaaaa
ctctgtgttttagaatatcagggcaagtatattttaaaagtgtgtggctgtgacgaatac
ttcctagaaaaatatcctctgagtcagtataagtatataagaagctgtataatgcttggg
aggatgcccaatttgatgctgatggctaaagaaagcctctactctcaactgccaatggac
tgttttacaatgccatcttattccagacgcatctccacagctacaccatatatgaatgga
gaaacatctacaaaatccctttgggttataaatagtgcacttagaataaaaattctttgt
gcaacctatgtgaatgtaaatattcgagacattgacaagatctatgttcgaacaggtatc
taccatggaggagaacccttatgtgataatgtgaacactcaaagagtaccttgttccaat
cccaggtggaatgaatggctgaattacgatatatacattcctgatcttcctcgtgctgct
cgactttgcctttctatttgttctgttaaaggccgaaagggtgctaaagaggaacactgc
ccattggcctggggaaatataaacttgtttgattacacagatactctagtatctggaaaa
atggctttgaatctttggccagtacctcatggactagaagatttgctgaaccctattggt
gttactggatcaaatccaaataaagaaactccatgtttagagttggagtttgactggttc
agcagtgtggtaaagttcccagatatgtcagtgattgaagagcatgccaactggtctgta
tcccgagaagcaggatttagttattcccatgcaggactgagtaacagactagctagagac
aatgaattaagagaaaatgataaagaacagctccgagcaatttgtacacgagatcctcta
tctgaaatcactgagcaagagaaagattttctgtggagccacagacactattgtgtaact
atccctgaaattctacccaaattgcttctgtctgttaaatggaattctagagatgaagta
gctcagatgtactgcttggttaaagattggcctccaatcaaacctgaacaggctatggag
cttctagactgcaattacccagatcctatggttcgaggttttgctgttcgatgcttagaa
aaatatttaacagatgacaaactttctcagtacctaattcagctagtacaggtcctaaaa
tatgaacagtatttggataacctacttgtgaggtttttactcaaaaaagcattgactaat
caaaggattgggcactttttcttttggcatttaaaatctgagatgcacaataaaacagtt
agtcagaggtttggcctgcttttggagtcctattgccgtgcatgtgggatgtatttgaag
cacctgaataggcaggttgaggctatggaaaagctcattaacttaactgacattctcaaa
caagagaagaaggatgaaacacaaaaggtacagatgaaatttttagttgagcaaatgcgg
cgaccagatttcatggatgctctacagggctttctgtcgcctctaaaccctgctcatcag
ctgggaaatctcaggcttgaagagtgtcgaattatgtcctctgcaaaaaggccactgtgg
ttgaattgggagaacccagacatcatgtcagaattactctttcagaacaatgagatcatc
tttaaaaatggggatgatttacggcaagatatgctaacacttcaaattattcgcattatg
gaaaatatctggcaaaatcaaggtcttgatcttcgaatgttaccttatggttgtctgtcc
attggtgactgtgtgggacttatcgaggtggtgagaaattctcacactattatgcaaatt
cagtgtaaaggaggcctgaaaggtgccctgcagttcaacagccacacactacatcagtgg
ctcaaagacaagaacaagggagaaatatatgatgcagccatcgatctatttacacgttca
tgtgctggatattgtgttgctaccttcattttgggaattggagatcgtcacaatagtaac
atcatggttaaagatgatggacaactgtttcatatagattttggacactttttggatcac
aagaagaaaaaatttggttataaacgagagcgtgtgccatttgttttgacacaagatttc
ttaatagtgattagtaaaggagcccaagaatgcacaaagacaagagaatttgagaggttt
caggagatgtgttacaaggcttatctagctattcggcagcatgccaatctcttcataaat
cttttctcaatgatgcttggctctggaatgccagaactacaatcttttgatgatattgca
tacattcgaaagaccctagctttagataaaactgagcaggaggctttggaatatttcatg
aaacaaatgaatgatgcacatcatggtggctggacaacaaaaatggattggatcttccac
acaattaagcagcatgctttgaactga

DBGET integrated database retrieval system