KEGG   Physeter catodon (sperm whale): 102977125
Entry
102977125         CDS       T06011                                 

Gene name
KRAS
Definition
(RefSeq) GTPase KRas isoform X2
  KO
K07827  GTPase KRas
Organism
pcad  Physeter catodon (sperm whale)
Pathway
pcad01521  EGFR tyrosine kinase inhibitor resistance
pcad01522  Endocrine resistance
pcad04010  MAPK signaling pathway
pcad04012  ErbB signaling pathway
pcad04014  Ras signaling pathway
pcad04015  Rap1 signaling pathway
pcad04062  Chemokine signaling pathway
pcad04068  FoxO signaling pathway
pcad04071  Sphingolipid signaling pathway
pcad04072  Phospholipase D signaling pathway
pcad04137  Mitophagy - animal
pcad04140  Autophagy - animal
pcad04150  mTOR signaling pathway
pcad04151  PI3K-Akt signaling pathway
pcad04210  Apoptosis
pcad04211  Longevity regulating pathway
pcad04213  Longevity regulating pathway - multiple species
pcad04218  Cellular senescence
pcad04360  Axon guidance
pcad04370  VEGF signaling pathway
pcad04371  Apelin signaling pathway
pcad04540  Gap junction
pcad04550  Signaling pathways regulating pluripotency of stem cells
pcad04625  C-type lectin receptor signaling pathway
pcad04650  Natural killer cell mediated cytotoxicity
pcad04660  T cell receptor signaling pathway
pcad04662  B cell receptor signaling pathway
pcad04664  Fc epsilon RI signaling pathway
pcad04714  Thermogenesis
pcad04720  Long-term potentiation
pcad04722  Neurotrophin signaling pathway
pcad04725  Cholinergic synapse
pcad04726  Serotonergic synapse
pcad04730  Long-term depression
pcad04810  Regulation of actin cytoskeleton
pcad04910  Insulin signaling pathway
pcad04912  GnRH signaling pathway
pcad04914  Progesterone-mediated oocyte maturation
pcad04915  Estrogen signaling pathway
pcad04916  Melanogenesis
pcad04917  Prolactin signaling pathway
pcad04919  Thyroid hormone signaling pathway
pcad04921  Oxytocin signaling pathway
pcad04926  Relaxin signaling pathway
pcad04929  GnRH secretion
pcad04933  AGE-RAGE signaling pathway in diabetic complications
pcad04935  Growth hormone synthesis, secretion and action
pcad04960  Aldosterone-regulated sodium reabsorption
pcad05010  Alzheimer disease
pcad05022  Pathways of neurodegeneration - multiple diseases
pcad05034  Alcoholism
pcad05160  Hepatitis C
pcad05161  Hepatitis B
pcad05163  Human cytomegalovirus infection
pcad05165  Human papillomavirus infection
pcad05166  Human T-cell leukemia virus 1 infection
pcad05167  Kaposi sarcoma-associated herpesvirus infection
pcad05170  Human immunodeficiency virus 1 infection
pcad05200  Pathways in cancer
pcad05203  Viral carcinogenesis
pcad05205  Proteoglycans in cancer
pcad05206  MicroRNAs in cancer
pcad05210  Colorectal cancer
pcad05211  Renal cell carcinoma
pcad05212  Pancreatic cancer
pcad05213  Endometrial cancer
pcad05214  Glioma
pcad05215  Prostate cancer
pcad05216  Thyroid cancer
pcad05218  Melanoma
pcad05219  Bladder cancer
pcad05220  Chronic myeloid leukemia
pcad05221  Acute myeloid leukemia
pcad05223  Non-small cell lung cancer
pcad05224  Breast cancer
pcad05225  Hepatocellular carcinoma
pcad05226  Gastric cancer
pcad05230  Central carbon metabolism in cancer
pcad05231  Choline metabolism in cancer
pcad05235  PD-L1 expression and PD-1 checkpoint pathway in cancer
Brite
KEGG Orthology (KO) [BR:pcad00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04010 MAPK signaling pathway
    102977125 (KRAS)
   04012 ErbB signaling pathway
    102977125 (KRAS)
   04014 Ras signaling pathway
    102977125 (KRAS)
   04015 Rap1 signaling pathway
    102977125 (KRAS)
   04370 VEGF signaling pathway
    102977125 (KRAS)
   04371 Apelin signaling pathway
    102977125 (KRAS)
   04068 FoxO signaling pathway
    102977125 (KRAS)
   04072 Phospholipase D signaling pathway
    102977125 (KRAS)
   04071 Sphingolipid signaling pathway
    102977125 (KRAS)
   04151 PI3K-Akt signaling pathway
    102977125 (KRAS)
   04150 mTOR signaling pathway
    102977125 (KRAS)
 09140 Cellular Processes
  09141 Transport and catabolism
   04140 Autophagy - animal
    102977125 (KRAS)
   04137 Mitophagy - animal
    102977125 (KRAS)
  09143 Cell growth and death
   04210 Apoptosis
    102977125 (KRAS)
   04218 Cellular senescence
    102977125 (KRAS)
  09144 Cellular community - eukaryotes
   04540 Gap junction
    102977125 (KRAS)
   04550 Signaling pathways regulating pluripotency of stem cells
    102977125 (KRAS)
  09142 Cell motility
   04810 Regulation of actin cytoskeleton
    102977125 (KRAS)
 09150 Organismal Systems
  09151 Immune system
   04625 C-type lectin receptor signaling pathway
    102977125 (KRAS)
   04650 Natural killer cell mediated cytotoxicity
    102977125 (KRAS)
   04660 T cell receptor signaling pathway
    102977125 (KRAS)
   04662 B cell receptor signaling pathway
    102977125 (KRAS)
   04664 Fc epsilon RI signaling pathway
    102977125 (KRAS)
   04062 Chemokine signaling pathway
    102977125 (KRAS)
  09152 Endocrine system
   04910 Insulin signaling pathway
    102977125 (KRAS)
   04929 GnRH secretion
    102977125 (KRAS)
   04912 GnRH signaling pathway
    102977125 (KRAS)
   04915 Estrogen signaling pathway
    102977125 (KRAS)
   04914 Progesterone-mediated oocyte maturation
    102977125 (KRAS)
   04917 Prolactin signaling pathway
    102977125 (KRAS)
   04921 Oxytocin signaling pathway
    102977125 (KRAS)
   04926 Relaxin signaling pathway
    102977125 (KRAS)
   04935 Growth hormone synthesis, secretion and action
    102977125 (KRAS)
   04919 Thyroid hormone signaling pathway
    102977125 (KRAS)
   04916 Melanogenesis
    102977125 (KRAS)
  09155 Excretory system
   04960 Aldosterone-regulated sodium reabsorption
    102977125 (KRAS)
  09156 Nervous system
   04725 Cholinergic synapse
    102977125 (KRAS)
   04726 Serotonergic synapse
    102977125 (KRAS)
   04720 Long-term potentiation
    102977125 (KRAS)
   04730 Long-term depression
    102977125 (KRAS)
   04722 Neurotrophin signaling pathway
    102977125 (KRAS)
  09158 Development and regeneration
   04360 Axon guidance
    102977125 (KRAS)
  09149 Aging
   04211 Longevity regulating pathway
    102977125 (KRAS)
   04213 Longevity regulating pathway - multiple species
    102977125 (KRAS)
  09159 Environmental adaptation
   04714 Thermogenesis
    102977125 (KRAS)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    102977125 (KRAS)
   05206 MicroRNAs in cancer
    102977125 (KRAS)
   05205 Proteoglycans in cancer
    102977125 (KRAS)
   05203 Viral carcinogenesis
    102977125 (KRAS)
   05230 Central carbon metabolism in cancer
    102977125 (KRAS)
   05231 Choline metabolism in cancer
    102977125 (KRAS)
   05235 PD-L1 expression and PD-1 checkpoint pathway in cancer
    102977125 (KRAS)
  09162 Cancer: specific types
   05210 Colorectal cancer
    102977125 (KRAS)
   05212 Pancreatic cancer
    102977125 (KRAS)
   05225 Hepatocellular carcinoma
    102977125 (KRAS)
   05226 Gastric cancer
    102977125 (KRAS)
   05214 Glioma
    102977125 (KRAS)
   05216 Thyroid cancer
    102977125 (KRAS)
   05221 Acute myeloid leukemia
    102977125 (KRAS)
   05220 Chronic myeloid leukemia
    102977125 (KRAS)
   05218 Melanoma
    102977125 (KRAS)
   05211 Renal cell carcinoma
    102977125 (KRAS)
   05219 Bladder cancer
    102977125 (KRAS)
   05215 Prostate cancer
    102977125 (KRAS)
   05213 Endometrial cancer
    102977125 (KRAS)
   05224 Breast cancer
    102977125 (KRAS)
   05223 Non-small cell lung cancer
    102977125 (KRAS)
  09164 Neurodegenerative disease
   05010 Alzheimer disease
    102977125 (KRAS)
   05022 Pathways of neurodegeneration - multiple diseases
    102977125 (KRAS)
  09165 Substance dependence
   05034 Alcoholism
    102977125 (KRAS)
  09167 Endocrine and metabolic disease
   04933 AGE-RAGE signaling pathway in diabetic complications
    102977125 (KRAS)
  09172 Infectious disease: viral
   05166 Human T-cell leukemia virus 1 infection
    102977125 (KRAS)
   05170 Human immunodeficiency virus 1 infection
    102977125 (KRAS)
   05161 Hepatitis B
    102977125 (KRAS)
   05160 Hepatitis C
    102977125 (KRAS)
   05163 Human cytomegalovirus infection
    102977125 (KRAS)
   05167 Kaposi sarcoma-associated herpesvirus infection
    102977125 (KRAS)
   05165 Human papillomavirus infection
    102977125 (KRAS)
  09176 Drug resistance: antineoplastic
   01521 EGFR tyrosine kinase inhibitor resistance
    102977125 (KRAS)
   01522 Endocrine resistance
    102977125 (KRAS)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04131 Membrane trafficking [BR:pcad04131]
    102977125 (KRAS)
  09183 Protein families: signaling and cellular processes
   04031 GTP-binding proteins [BR:pcad04031]
    102977125 (KRAS)
Membrane trafficking [BR:pcad04131]
 Endocytosis
  Macropinocytosis
   Ras GTPases
    102977125 (KRAS)
GTP-binding proteins [BR:pcad04031]
 Small (monomeric) G-proteins
  Ras Family
   Ras [OT]
    102977125 (KRAS)
SSDB
Motif
Pfam: Ras Roc Arf GTP_EFTU RsgA_GTPase MMR_HSR1 MeaB G-alpha FeoB_N ATP_bind_1 Septin NPR1_interact AAA_25
Other DBs
NCBI-GeneID: 102977125
NCBI-ProteinID: XP_023984860
UniProt: A0A2Y9T1N8
LinkDB
Position
6
AA seq 188 aa
MTEYKLVVVGAGGVGKSALTIQLIQNHFVDEYDPTIEDSYRKQVVIDGETCLLDILDTAG
QEEYSAMRDQYMRTGEGFLCVFAINNTKSFEDIHHYREQIKRVKDSEDVPMVLVGNKCDL
PSRTVDTKQAQDLARSYGIPFIETSAKTRQGVDDAFYTLVREIRKHKEKMSKEGKKKKKK
SKTKCIIM
NT seq 567 nt   +upstreamnt  +downstreamnt
atgactgaatataaacttgtggtagttggagctggtggcgtaggcaagagtgccttgacg
atacagctaattcagaatcactttgtggatgaatatgatcctacgatagaggattcctac
agaaaacaagtagtaattgatggagaaacctgtctcttggatattctcgacacagcaggt
caagaggagtacagtgcaatgagggaccagtacatgaggactggggagggctttctttgt
gtatttgccataaataatactaaatcatttgaagatattcaccattatagagaacaaata
aaaagagttaaagactctgaagatgtacctatggttctagtaggaaataaatgtgatttg
ccttctagaacagtagacacaaaacaggctcaggacttagcaagaagttatggaattcct
tttattgaaacatctgcaaagacaagacagggtgttgacgatgccttctatacattagtt
cgagaaattcgaaaacataaagaaaagatgagcaaagaaggtaaaaagaagaaaaagaag
tcaaagacaaagtgtataattatgtaa

KEGG   Physeter catodon (sperm whale): 102982641
Entry
102982641         CDS       T06011                                 

Gene name
NRAS
Definition
(RefSeq) LOW QUALITY PROTEIN: GTPase NRas
  KO
K07828  GTPase NRas
Organism
pcad  Physeter catodon (sperm whale)
Pathway
pcad01521  EGFR tyrosine kinase inhibitor resistance
pcad01522  Endocrine resistance
pcad04010  MAPK signaling pathway
pcad04012  ErbB signaling pathway
pcad04014  Ras signaling pathway
pcad04015  Rap1 signaling pathway
pcad04062  Chemokine signaling pathway
pcad04068  FoxO signaling pathway
pcad04071  Sphingolipid signaling pathway
pcad04072  Phospholipase D signaling pathway
pcad04137  Mitophagy - animal
pcad04140  Autophagy - animal
pcad04150  mTOR signaling pathway
pcad04151  PI3K-Akt signaling pathway
pcad04210  Apoptosis
pcad04211  Longevity regulating pathway
pcad04213  Longevity regulating pathway - multiple species
pcad04218  Cellular senescence
pcad04360  Axon guidance
pcad04370  VEGF signaling pathway
pcad04371  Apelin signaling pathway
pcad04540  Gap junction
pcad04550  Signaling pathways regulating pluripotency of stem cells
pcad04625  C-type lectin receptor signaling pathway
pcad04650  Natural killer cell mediated cytotoxicity
pcad04660  T cell receptor signaling pathway
pcad04662  B cell receptor signaling pathway
pcad04664  Fc epsilon RI signaling pathway
pcad04714  Thermogenesis
pcad04720  Long-term potentiation
pcad04722  Neurotrophin signaling pathway
pcad04725  Cholinergic synapse
pcad04726  Serotonergic synapse
pcad04730  Long-term depression
pcad04810  Regulation of actin cytoskeleton
pcad04910  Insulin signaling pathway
pcad04912  GnRH signaling pathway
pcad04915  Estrogen signaling pathway
pcad04916  Melanogenesis
pcad04917  Prolactin signaling pathway
pcad04919  Thyroid hormone signaling pathway
pcad04921  Oxytocin signaling pathway
pcad04926  Relaxin signaling pathway
pcad04929  GnRH secretion
pcad04933  AGE-RAGE signaling pathway in diabetic complications
pcad04935  Growth hormone synthesis, secretion and action
pcad05010  Alzheimer disease
pcad05022  Pathways of neurodegeneration - multiple diseases
pcad05034  Alcoholism
pcad05160  Hepatitis C
pcad05161  Hepatitis B
pcad05163  Human cytomegalovirus infection
pcad05165  Human papillomavirus infection
pcad05166  Human T-cell leukemia virus 1 infection
pcad05167  Kaposi sarcoma-associated herpesvirus infection
pcad05170  Human immunodeficiency virus 1 infection
pcad05200  Pathways in cancer
pcad05203  Viral carcinogenesis
pcad05205  Proteoglycans in cancer
pcad05206  MicroRNAs in cancer
pcad05210  Colorectal cancer
pcad05211  Renal cell carcinoma
pcad05213  Endometrial cancer
pcad05214  Glioma
pcad05215  Prostate cancer
pcad05216  Thyroid cancer
pcad05218  Melanoma
pcad05219  Bladder cancer
pcad05220  Chronic myeloid leukemia
pcad05221  Acute myeloid leukemia
pcad05223  Non-small cell lung cancer
pcad05224  Breast cancer
pcad05225  Hepatocellular carcinoma
pcad05226  Gastric cancer
pcad05230  Central carbon metabolism in cancer
pcad05231  Choline metabolism in cancer
pcad05235  PD-L1 expression and PD-1 checkpoint pathway in cancer
Brite
KEGG Orthology (KO) [BR:pcad00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04010 MAPK signaling pathway
    102982641 (NRAS)
   04012 ErbB signaling pathway
    102982641 (NRAS)
   04014 Ras signaling pathway
    102982641 (NRAS)
   04015 Rap1 signaling pathway
    102982641 (NRAS)
   04370 VEGF signaling pathway
    102982641 (NRAS)
   04371 Apelin signaling pathway
    102982641 (NRAS)
   04068 FoxO signaling pathway
    102982641 (NRAS)
   04072 Phospholipase D signaling pathway
    102982641 (NRAS)
   04071 Sphingolipid signaling pathway
    102982641 (NRAS)
   04151 PI3K-Akt signaling pathway
    102982641 (NRAS)
   04150 mTOR signaling pathway
    102982641 (NRAS)
 09140 Cellular Processes
  09141 Transport and catabolism
   04140 Autophagy - animal
    102982641 (NRAS)
   04137 Mitophagy - animal
    102982641 (NRAS)
  09143 Cell growth and death
   04210 Apoptosis
    102982641 (NRAS)
   04218 Cellular senescence
    102982641 (NRAS)
  09144 Cellular community - eukaryotes
   04540 Gap junction
    102982641 (NRAS)
   04550 Signaling pathways regulating pluripotency of stem cells
    102982641 (NRAS)
  09142 Cell motility
   04810 Regulation of actin cytoskeleton
    102982641 (NRAS)
 09150 Organismal Systems
  09151 Immune system
   04625 C-type lectin receptor signaling pathway
    102982641 (NRAS)
   04650 Natural killer cell mediated cytotoxicity
    102982641 (NRAS)
   04660 T cell receptor signaling pathway
    102982641 (NRAS)
   04662 B cell receptor signaling pathway
    102982641 (NRAS)
   04664 Fc epsilon RI signaling pathway
    102982641 (NRAS)
   04062 Chemokine signaling pathway
    102982641 (NRAS)
  09152 Endocrine system
   04910 Insulin signaling pathway
    102982641 (NRAS)
   04929 GnRH secretion
    102982641 (NRAS)
   04912 GnRH signaling pathway
    102982641 (NRAS)
   04915 Estrogen signaling pathway
    102982641 (NRAS)
   04917 Prolactin signaling pathway
    102982641 (NRAS)
   04921 Oxytocin signaling pathway
    102982641 (NRAS)
   04926 Relaxin signaling pathway
    102982641 (NRAS)
   04935 Growth hormone synthesis, secretion and action
    102982641 (NRAS)
   04919 Thyroid hormone signaling pathway
    102982641 (NRAS)
   04916 Melanogenesis
    102982641 (NRAS)
  09156 Nervous system
   04725 Cholinergic synapse
    102982641 (NRAS)
   04726 Serotonergic synapse
    102982641 (NRAS)
   04720 Long-term potentiation
    102982641 (NRAS)
   04730 Long-term depression
    102982641 (NRAS)
   04722 Neurotrophin signaling pathway
    102982641 (NRAS)
  09158 Development and regeneration
   04360 Axon guidance
    102982641 (NRAS)
  09149 Aging
   04211 Longevity regulating pathway
    102982641 (NRAS)
   04213 Longevity regulating pathway - multiple species
    102982641 (NRAS)
  09159 Environmental adaptation
   04714 Thermogenesis
    102982641 (NRAS)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    102982641 (NRAS)
   05206 MicroRNAs in cancer
    102982641 (NRAS)
   05205 Proteoglycans in cancer
    102982641 (NRAS)
   05203 Viral carcinogenesis
    102982641 (NRAS)
   05230 Central carbon metabolism in cancer
    102982641 (NRAS)
   05231 Choline metabolism in cancer
    102982641 (NRAS)
   05235 PD-L1 expression and PD-1 checkpoint pathway in cancer
    102982641 (NRAS)
  09162 Cancer: specific types
   05210 Colorectal cancer
    102982641 (NRAS)
   05225 Hepatocellular carcinoma
    102982641 (NRAS)
   05226 Gastric cancer
    102982641 (NRAS)
   05214 Glioma
    102982641 (NRAS)
   05216 Thyroid cancer
    102982641 (NRAS)
   05221 Acute myeloid leukemia
    102982641 (NRAS)
   05220 Chronic myeloid leukemia
    102982641 (NRAS)
   05218 Melanoma
    102982641 (NRAS)
   05211 Renal cell carcinoma
    102982641 (NRAS)
   05219 Bladder cancer
    102982641 (NRAS)
   05215 Prostate cancer
    102982641 (NRAS)
   05213 Endometrial cancer
    102982641 (NRAS)
   05224 Breast cancer
    102982641 (NRAS)
   05223 Non-small cell lung cancer
    102982641 (NRAS)
  09164 Neurodegenerative disease
   05010 Alzheimer disease
    102982641 (NRAS)
   05022 Pathways of neurodegeneration - multiple diseases
    102982641 (NRAS)
  09165 Substance dependence
   05034 Alcoholism
    102982641 (NRAS)
  09167 Endocrine and metabolic disease
   04933 AGE-RAGE signaling pathway in diabetic complications
    102982641 (NRAS)
  09172 Infectious disease: viral
   05166 Human T-cell leukemia virus 1 infection
    102982641 (NRAS)
   05170 Human immunodeficiency virus 1 infection
    102982641 (NRAS)
   05161 Hepatitis B
    102982641 (NRAS)
   05160 Hepatitis C
    102982641 (NRAS)
   05163 Human cytomegalovirus infection
    102982641 (NRAS)
   05167 Kaposi sarcoma-associated herpesvirus infection
    102982641 (NRAS)
   05165 Human papillomavirus infection
    102982641 (NRAS)
  09176 Drug resistance: antineoplastic
   01521 EGFR tyrosine kinase inhibitor resistance
    102982641 (NRAS)
   01522 Endocrine resistance
    102982641 (NRAS)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04131 Membrane trafficking [BR:pcad04131]
    102982641 (NRAS)
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:pcad04147]
    102982641 (NRAS)
   04031 GTP-binding proteins [BR:pcad04031]
    102982641 (NRAS)
Membrane trafficking [BR:pcad04131]
 Endocytosis
  Macropinocytosis
   Ras GTPases
    102982641 (NRAS)
Exosome [BR:pcad04147]
 Exosomal proteins
  Exosomal proteins of haemopoietic cells  (B-cell, T-cell, DC-cell, reticulocyte, and mast cell)
   102982641 (NRAS)
  Exosomal proteins of other body fluids (saliva and urine)
   102982641 (NRAS)
  Exosomal proteins of breast cancer cells
   102982641 (NRAS)
  Exosomal proteins of colorectal cancer cells
   102982641 (NRAS)
GTP-binding proteins [BR:pcad04031]
 Small (monomeric) G-proteins
  Ras Family
   Ras [OT]
    102982641 (NRAS)
SSDB
Motif
Pfam: Ras Roc Arf GTP_EFTU RsgA_GTPase MMR_HSR1 FeoB_N Septin ParA
Other DBs
NCBI-GeneID: 102982641
NCBI-ProteinID: XP_028344775
UniProt: A0A455B752
LinkDB
Position
4
AA seq 217 aa
MLTTPCCQESSGIYELETKALGGSCWCEMTEYKLVVVGAGGVGKSALTIQLIQNHFVDEY
DPTIEDSYRKQVVIDGETCLLDILDTAGQEEYSAMXDXYMRTGEGFLCVFAINNSKSFAD
INLYREQIKRVKDSDDVPMVLVGNKCDLPTRTVDTKQAHELAKSYGIPFIETSAKTRQGV
EDAFYTLVREIRQYRMKKLNSSDDGTQGCMGLPCVVM
NT seq 654 nt   +upstreamnt  +downstreamnt
atgctgacgactccttgttgccaggaatcgagcggaatctacgagctggagacaaaggcc
ctgggcggttcttgctggtgtgaaatgactgagtacaaactggtggtggttggagcaggt
ggtgttgggaaaagcgcactgacaatccagctgatccagaaccactttgtagatgaatat
gatcccaccatagaggattcttaccgaaaacaggtggttatagatggtgaaacctgtctg
ttggacatactggatacagctggacaagaggagtacagtgccatgtgagactaatacatg
aggacaggcgaaggcttcctttgtgtatttgccatcaataatagcaaatcatttgcagat
attaacctctacagggaacagattaagcgtgtaaaagactcagatgatgtacctatggtg
ctagtaggaaacaagtgtgatttgccaacaaggacagttgacacaaaacaagcccatgaa
ctggccaagagttatgggattccattcattgaaacctcagccaagaccagacagggtgtt
gaagatgccttttacacactggtaagagaaatacgtcagtaccgaatgaaaaaactcaac
agcagtgatgatgggactcaaggttgtatgggattgccatgtgtggtgatgtaa

KEGG   Physeter catodon (sperm whale): 102992439
Entry
102992439         CDS       T06011                                 

Definition
(RefSeq) LOW QUALITY PROTEIN: GTPase NRas-like
  KO
K07828  GTPase NRas
Organism
pcad  Physeter catodon (sperm whale)
Pathway
pcad01521  EGFR tyrosine kinase inhibitor resistance
pcad01522  Endocrine resistance
pcad04010  MAPK signaling pathway
pcad04012  ErbB signaling pathway
pcad04014  Ras signaling pathway
pcad04015  Rap1 signaling pathway
pcad04062  Chemokine signaling pathway
pcad04068  FoxO signaling pathway
pcad04071  Sphingolipid signaling pathway
pcad04072  Phospholipase D signaling pathway
pcad04137  Mitophagy - animal
pcad04140  Autophagy - animal
pcad04150  mTOR signaling pathway
pcad04151  PI3K-Akt signaling pathway
pcad04210  Apoptosis
pcad04211  Longevity regulating pathway
pcad04213  Longevity regulating pathway - multiple species
pcad04218  Cellular senescence
pcad04360  Axon guidance
pcad04370  VEGF signaling pathway
pcad04371  Apelin signaling pathway
pcad04540  Gap junction
pcad04550  Signaling pathways regulating pluripotency of stem cells
pcad04625  C-type lectin receptor signaling pathway
pcad04650  Natural killer cell mediated cytotoxicity
pcad04660  T cell receptor signaling pathway
pcad04662  B cell receptor signaling pathway
pcad04664  Fc epsilon RI signaling pathway
pcad04714  Thermogenesis
pcad04720  Long-term potentiation
pcad04722  Neurotrophin signaling pathway
pcad04725  Cholinergic synapse
pcad04726  Serotonergic synapse
pcad04730  Long-term depression
pcad04810  Regulation of actin cytoskeleton
pcad04910  Insulin signaling pathway
pcad04912  GnRH signaling pathway
pcad04915  Estrogen signaling pathway
pcad04916  Melanogenesis
pcad04917  Prolactin signaling pathway
pcad04919  Thyroid hormone signaling pathway
pcad04921  Oxytocin signaling pathway
pcad04926  Relaxin signaling pathway
pcad04929  GnRH secretion
pcad04933  AGE-RAGE signaling pathway in diabetic complications
pcad04935  Growth hormone synthesis, secretion and action
pcad05010  Alzheimer disease
pcad05022  Pathways of neurodegeneration - multiple diseases
pcad05034  Alcoholism
pcad05160  Hepatitis C
pcad05161  Hepatitis B
pcad05163  Human cytomegalovirus infection
pcad05165  Human papillomavirus infection
pcad05166  Human T-cell leukemia virus 1 infection
pcad05167  Kaposi sarcoma-associated herpesvirus infection
pcad05170  Human immunodeficiency virus 1 infection
pcad05200  Pathways in cancer
pcad05203  Viral carcinogenesis
pcad05205  Proteoglycans in cancer
pcad05206  MicroRNAs in cancer
pcad05210  Colorectal cancer
pcad05211  Renal cell carcinoma
pcad05213  Endometrial cancer
pcad05214  Glioma
pcad05215  Prostate cancer
pcad05216  Thyroid cancer
pcad05218  Melanoma
pcad05219  Bladder cancer
pcad05220  Chronic myeloid leukemia
pcad05221  Acute myeloid leukemia
pcad05223  Non-small cell lung cancer
pcad05224  Breast cancer
pcad05225  Hepatocellular carcinoma
pcad05226  Gastric cancer
pcad05230  Central carbon metabolism in cancer
pcad05231  Choline metabolism in cancer
pcad05235  PD-L1 expression and PD-1 checkpoint pathway in cancer
Brite
KEGG Orthology (KO) [BR:pcad00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04010 MAPK signaling pathway
    102992439
   04012 ErbB signaling pathway
    102992439
   04014 Ras signaling pathway
    102992439
   04015 Rap1 signaling pathway
    102992439
   04370 VEGF signaling pathway
    102992439
   04371 Apelin signaling pathway
    102992439
   04068 FoxO signaling pathway
    102992439
   04072 Phospholipase D signaling pathway
    102992439
   04071 Sphingolipid signaling pathway
    102992439
   04151 PI3K-Akt signaling pathway
    102992439
   04150 mTOR signaling pathway
    102992439
 09140 Cellular Processes
  09141 Transport and catabolism
   04140 Autophagy - animal
    102992439
   04137 Mitophagy - animal
    102992439
  09143 Cell growth and death
   04210 Apoptosis
    102992439
   04218 Cellular senescence
    102992439
  09144 Cellular community - eukaryotes
   04540 Gap junction
    102992439
   04550 Signaling pathways regulating pluripotency of stem cells
    102992439
  09142 Cell motility
   04810 Regulation of actin cytoskeleton
    102992439
 09150 Organismal Systems
  09151 Immune system
   04625 C-type lectin receptor signaling pathway
    102992439
   04650 Natural killer cell mediated cytotoxicity
    102992439
   04660 T cell receptor signaling pathway
    102992439
   04662 B cell receptor signaling pathway
    102992439
   04664 Fc epsilon RI signaling pathway
    102992439
   04062 Chemokine signaling pathway
    102992439
  09152 Endocrine system
   04910 Insulin signaling pathway
    102992439
   04929 GnRH secretion
    102992439
   04912 GnRH signaling pathway
    102992439
   04915 Estrogen signaling pathway
    102992439
   04917 Prolactin signaling pathway
    102992439
   04921 Oxytocin signaling pathway
    102992439
   04926 Relaxin signaling pathway
    102992439
   04935 Growth hormone synthesis, secretion and action
    102992439
   04919 Thyroid hormone signaling pathway
    102992439
   04916 Melanogenesis
    102992439
  09156 Nervous system
   04725 Cholinergic synapse
    102992439
   04726 Serotonergic synapse
    102992439
   04720 Long-term potentiation
    102992439
   04730 Long-term depression
    102992439
   04722 Neurotrophin signaling pathway
    102992439
  09158 Development and regeneration
   04360 Axon guidance
    102992439
  09149 Aging
   04211 Longevity regulating pathway
    102992439
   04213 Longevity regulating pathway - multiple species
    102992439
  09159 Environmental adaptation
   04714 Thermogenesis
    102992439
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    102992439
   05206 MicroRNAs in cancer
    102992439
   05205 Proteoglycans in cancer
    102992439
   05203 Viral carcinogenesis
    102992439
   05230 Central carbon metabolism in cancer
    102992439
   05231 Choline metabolism in cancer
    102992439
   05235 PD-L1 expression and PD-1 checkpoint pathway in cancer
    102992439
  09162 Cancer: specific types
   05210 Colorectal cancer
    102992439
   05225 Hepatocellular carcinoma
    102992439
   05226 Gastric cancer
    102992439
   05214 Glioma
    102992439
   05216 Thyroid cancer
    102992439
   05221 Acute myeloid leukemia
    102992439
   05220 Chronic myeloid leukemia
    102992439
   05218 Melanoma
    102992439
   05211 Renal cell carcinoma
    102992439
   05219 Bladder cancer
    102992439
   05215 Prostate cancer
    102992439
   05213 Endometrial cancer
    102992439
   05224 Breast cancer
    102992439
   05223 Non-small cell lung cancer
    102992439
  09164 Neurodegenerative disease
   05010 Alzheimer disease
    102992439
   05022 Pathways of neurodegeneration - multiple diseases
    102992439
  09165 Substance dependence
   05034 Alcoholism
    102992439
  09167 Endocrine and metabolic disease
   04933 AGE-RAGE signaling pathway in diabetic complications
    102992439
  09172 Infectious disease: viral
   05166 Human T-cell leukemia virus 1 infection
    102992439
   05170 Human immunodeficiency virus 1 infection
    102992439
   05161 Hepatitis B
    102992439
   05160 Hepatitis C
    102992439
   05163 Human cytomegalovirus infection
    102992439
   05167 Kaposi sarcoma-associated herpesvirus infection
    102992439
   05165 Human papillomavirus infection
    102992439
  09176 Drug resistance: antineoplastic
   01521 EGFR tyrosine kinase inhibitor resistance
    102992439
   01522 Endocrine resistance
    102992439
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04131 Membrane trafficking [BR:pcad04131]
    102992439
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:pcad04147]
    102992439
   04031 GTP-binding proteins [BR:pcad04031]
    102992439
Membrane trafficking [BR:pcad04131]
 Endocytosis
  Macropinocytosis
   Ras GTPases
    102992439
Exosome [BR:pcad04147]
 Exosomal proteins
  Exosomal proteins of haemopoietic cells  (B-cell, T-cell, DC-cell, reticulocyte, and mast cell)
   102992439
  Exosomal proteins of other body fluids (saliva and urine)
   102992439
  Exosomal proteins of breast cancer cells
   102992439
  Exosomal proteins of colorectal cancer cells
   102992439
GTP-binding proteins [BR:pcad04031]
 Small (monomeric) G-proteins
  Ras Family
   Ras [OT]
    102992439
SSDB
Motif
Pfam: Ras Roc Arf GTP_EFTU RsgA_GTPase MMR_HSR1 FeoB_N Septin CbiA
Other DBs
NCBI-GeneID: 102992439
NCBI-ProteinID: XP_028351280
UniProt: A0A455BQM5
LinkDB
Position
11
AA seq 189 aa
MTEYKLVVVGSGGVGKSALTIQLIQNHFVDEYDPTIEDSYQKQVVIDGETCLLDILDTAG
QEEYSAMXDXYMRTGEGFLCVFAINNSKSFADINLYREQIKRVKDSDDVPMVLVGNKCDL
PARTVDTKQAHELAKSYGIPFIETSAKTRQGVEDAFYTLVREIRQYRMKKLNSSDDGTQG
CMGLPCVVM
NT seq 570 nt   +upstreamnt  +downstreamnt
atgactgagtacaaactggtggtggttggatcaggtggtgttgggaaaagcgcactgaca
atccagctgatccagaaccactttgtagatgaatacgatcccaccatagaggattcttac
caaaaacaggtggttatagatggtgaaacctgtctgttggacatactggatacagctgga
caagaggagtacagtgccatgtgagactaatacatgaggacaggcgaaggcttcctttgt
gtatttgccatcaataatagcaaatcatttgcagatattaacctctacagggaacagatt
aagcgtgtaaaagactcagatgatgtacctatggtgctagtaggaaacaagtgtgatttg
ccagcaaggacagttgacacaaaacaagcccatgaactggccaagagttacgggattcca
ttcattgaaacctcagccaagaccagacagggtgttgaagatgccttttacacactggta
agagaaatacgtcagtaccgaatgaaaaaactcaacagcagtgatgatgggactcaaggt
tgtatgggattgccatgtgtggtgatgtaa

KEGG   Physeter catodon (sperm whale): 102994715
Entry
102994715         CDS       T06011                                 

Gene name
HRAS
Definition
(RefSeq) GTPase HRas isoform X2
  KO
K02833  GTPase HRas
Organism
pcad  Physeter catodon (sperm whale)
Pathway
pcad01521  EGFR tyrosine kinase inhibitor resistance
pcad01522  Endocrine resistance
pcad04010  MAPK signaling pathway
pcad04012  ErbB signaling pathway
pcad04014  Ras signaling pathway
pcad04015  Rap1 signaling pathway
pcad04062  Chemokine signaling pathway
pcad04068  FoxO signaling pathway
pcad04071  Sphingolipid signaling pathway
pcad04072  Phospholipase D signaling pathway
pcad04137  Mitophagy - animal
pcad04140  Autophagy - animal
pcad04144  Endocytosis
pcad04150  mTOR signaling pathway
pcad04151  PI3K-Akt signaling pathway
pcad04210  Apoptosis
pcad04211  Longevity regulating pathway
pcad04213  Longevity regulating pathway - multiple species
pcad04218  Cellular senescence
pcad04360  Axon guidance
pcad04370  VEGF signaling pathway
pcad04371  Apelin signaling pathway
pcad04510  Focal adhesion
pcad04540  Gap junction
pcad04550  Signaling pathways regulating pluripotency of stem cells
pcad04625  C-type lectin receptor signaling pathway
pcad04630  JAK-STAT signaling pathway
pcad04650  Natural killer cell mediated cytotoxicity
pcad04660  T cell receptor signaling pathway
pcad04662  B cell receptor signaling pathway
pcad04664  Fc epsilon RI signaling pathway
pcad04714  Thermogenesis
pcad04720  Long-term potentiation
pcad04722  Neurotrophin signaling pathway
pcad04725  Cholinergic synapse
pcad04726  Serotonergic synapse
pcad04730  Long-term depression
pcad04810  Regulation of actin cytoskeleton
pcad04910  Insulin signaling pathway
pcad04912  GnRH signaling pathway
pcad04915  Estrogen signaling pathway
pcad04916  Melanogenesis
pcad04917  Prolactin signaling pathway
pcad04919  Thyroid hormone signaling pathway
pcad04921  Oxytocin signaling pathway
pcad04926  Relaxin signaling pathway
pcad04929  GnRH secretion
pcad04933  AGE-RAGE signaling pathway in diabetic complications
pcad04935  Growth hormone synthesis, secretion and action
pcad05010  Alzheimer disease
pcad05022  Pathways of neurodegeneration - multiple diseases
pcad05034  Alcoholism
pcad05132  Salmonella infection
pcad05160  Hepatitis C
pcad05161  Hepatitis B
pcad05163  Human cytomegalovirus infection
pcad05165  Human papillomavirus infection
pcad05166  Human T-cell leukemia virus 1 infection
pcad05167  Kaposi sarcoma-associated herpesvirus infection
pcad05170  Human immunodeficiency virus 1 infection
pcad05200  Pathways in cancer
pcad05203  Viral carcinogenesis
pcad05205  Proteoglycans in cancer
pcad05206  MicroRNAs in cancer
pcad05210  Colorectal cancer
pcad05211  Renal cell carcinoma
pcad05213  Endometrial cancer
pcad05214  Glioma
pcad05215  Prostate cancer
pcad05216  Thyroid cancer
pcad05218  Melanoma
pcad05219  Bladder cancer
pcad05220  Chronic myeloid leukemia
pcad05221  Acute myeloid leukemia
pcad05223  Non-small cell lung cancer
pcad05224  Breast cancer
pcad05225  Hepatocellular carcinoma
pcad05226  Gastric cancer
pcad05230  Central carbon metabolism in cancer
pcad05231  Choline metabolism in cancer
pcad05235  PD-L1 expression and PD-1 checkpoint pathway in cancer
Brite
KEGG Orthology (KO) [BR:pcad00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04010 MAPK signaling pathway
    102994715 (HRAS)
   04012 ErbB signaling pathway
    102994715 (HRAS)
   04014 Ras signaling pathway
    102994715 (HRAS)
   04015 Rap1 signaling pathway
    102994715 (HRAS)
   04370 VEGF signaling pathway
    102994715 (HRAS)
   04371 Apelin signaling pathway
    102994715 (HRAS)
   04630 JAK-STAT signaling pathway
    102994715 (HRAS)
   04068 FoxO signaling pathway
    102994715 (HRAS)
   04072 Phospholipase D signaling pathway
    102994715 (HRAS)
   04071 Sphingolipid signaling pathway
    102994715 (HRAS)
   04151 PI3K-Akt signaling pathway
    102994715 (HRAS)
   04150 mTOR signaling pathway
    102994715 (HRAS)
 09140 Cellular Processes
  09141 Transport and catabolism
   04144 Endocytosis
    102994715 (HRAS)
   04140 Autophagy - animal
    102994715 (HRAS)
   04137 Mitophagy - animal
    102994715 (HRAS)
  09143 Cell growth and death
   04210 Apoptosis
    102994715 (HRAS)
   04218 Cellular senescence
    102994715 (HRAS)
  09144 Cellular community - eukaryotes
   04510 Focal adhesion
    102994715 (HRAS)
   04540 Gap junction
    102994715 (HRAS)
   04550 Signaling pathways regulating pluripotency of stem cells
    102994715 (HRAS)
  09142 Cell motility
   04810 Regulation of actin cytoskeleton
    102994715 (HRAS)
 09150 Organismal Systems
  09151 Immune system
   04625 C-type lectin receptor signaling pathway
    102994715 (HRAS)
   04650 Natural killer cell mediated cytotoxicity
    102994715 (HRAS)
   04660 T cell receptor signaling pathway
    102994715 (HRAS)
   04662 B cell receptor signaling pathway
    102994715 (HRAS)
   04664 Fc epsilon RI signaling pathway
    102994715 (HRAS)
   04062 Chemokine signaling pathway
    102994715 (HRAS)
  09152 Endocrine system
   04910 Insulin signaling pathway
    102994715 (HRAS)
   04929 GnRH secretion
    102994715 (HRAS)
   04912 GnRH signaling pathway
    102994715 (HRAS)
   04915 Estrogen signaling pathway
    102994715 (HRAS)
   04917 Prolactin signaling pathway
    102994715 (HRAS)
   04921 Oxytocin signaling pathway
    102994715 (HRAS)
   04926 Relaxin signaling pathway
    102994715 (HRAS)
   04935 Growth hormone synthesis, secretion and action
    102994715 (HRAS)
   04919 Thyroid hormone signaling pathway
    102994715 (HRAS)
   04916 Melanogenesis
    102994715 (HRAS)
  09156 Nervous system
   04725 Cholinergic synapse
    102994715 (HRAS)
   04726 Serotonergic synapse
    102994715 (HRAS)
   04720 Long-term potentiation
    102994715 (HRAS)
   04730 Long-term depression
    102994715 (HRAS)
   04722 Neurotrophin signaling pathway
    102994715 (HRAS)
  09158 Development and regeneration
   04360 Axon guidance
    102994715 (HRAS)
  09149 Aging
   04211 Longevity regulating pathway
    102994715 (HRAS)
   04213 Longevity regulating pathway - multiple species
    102994715 (HRAS)
  09159 Environmental adaptation
   04714 Thermogenesis
    102994715 (HRAS)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    102994715 (HRAS)
   05206 MicroRNAs in cancer
    102994715 (HRAS)
   05205 Proteoglycans in cancer
    102994715 (HRAS)
   05203 Viral carcinogenesis
    102994715 (HRAS)
   05230 Central carbon metabolism in cancer
    102994715 (HRAS)
   05231 Choline metabolism in cancer
    102994715 (HRAS)
   05235 PD-L1 expression and PD-1 checkpoint pathway in cancer
    102994715 (HRAS)
  09162 Cancer: specific types
   05210 Colorectal cancer
    102994715 (HRAS)
   05225 Hepatocellular carcinoma
    102994715 (HRAS)
   05226 Gastric cancer
    102994715 (HRAS)
   05214 Glioma
    102994715 (HRAS)
   05216 Thyroid cancer
    102994715 (HRAS)
   05221 Acute myeloid leukemia
    102994715 (HRAS)
   05220 Chronic myeloid leukemia
    102994715 (HRAS)
   05218 Melanoma
    102994715 (HRAS)
   05211 Renal cell carcinoma
    102994715 (HRAS)
   05219 Bladder cancer
    102994715 (HRAS)
   05215 Prostate cancer
    102994715 (HRAS)
   05213 Endometrial cancer
    102994715 (HRAS)
   05224 Breast cancer
    102994715 (HRAS)
   05223 Non-small cell lung cancer
    102994715 (HRAS)
  09164 Neurodegenerative disease
   05010 Alzheimer disease
    102994715 (HRAS)
   05022 Pathways of neurodegeneration - multiple diseases
    102994715 (HRAS)
  09165 Substance dependence
   05034 Alcoholism
    102994715 (HRAS)
  09167 Endocrine and metabolic disease
   04933 AGE-RAGE signaling pathway in diabetic complications
    102994715 (HRAS)
  09171 Infectious disease: bacterial
   05132 Salmonella infection
    102994715 (HRAS)
  09172 Infectious disease: viral
   05166 Human T-cell leukemia virus 1 infection
    102994715 (HRAS)
   05170 Human immunodeficiency virus 1 infection
    102994715 (HRAS)
   05161 Hepatitis B
    102994715 (HRAS)
   05160 Hepatitis C
    102994715 (HRAS)
   05163 Human cytomegalovirus infection
    102994715 (HRAS)
   05167 Kaposi sarcoma-associated herpesvirus infection
    102994715 (HRAS)
   05165 Human papillomavirus infection
    102994715 (HRAS)
  09176 Drug resistance: antineoplastic
   01521 EGFR tyrosine kinase inhibitor resistance
    102994715 (HRAS)
   01522 Endocrine resistance
    102994715 (HRAS)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04131 Membrane trafficking [BR:pcad04131]
    102994715 (HRAS)
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:pcad04147]
    102994715 (HRAS)
   04031 GTP-binding proteins [BR:pcad04031]
    102994715 (HRAS)
Membrane trafficking [BR:pcad04131]
 Endocytosis
  Macropinocytosis
   Ras GTPases
    102994715 (HRAS)
Exosome [BR:pcad04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   102994715 (HRAS)
  Exosomal proteins of colorectal cancer cells
   102994715 (HRAS)
GTP-binding proteins [BR:pcad04031]
 Small (monomeric) G-proteins
  Ras Family
   Ras [OT]
    102994715 (HRAS)
SSDB
Motif
Pfam: Ras Roc Arf GTP_EFTU RsgA_GTPase MMR_HSR1 FeoB_N Gtr1_RagA AAA_22 ATP_bind_1 Septin Ldh_1_N AAA_25 AAA_16
Other DBs
NCBI-GeneID: 102994715
NCBI-ProteinID: XP_007108716
UniProt: A0A2Y9EVH5
LinkDB
Position
18
AA seq 189 aa
MTEYKLVVVGAGGVGKSALTIQLIQNHFVDEYDPTIEDSYRKQVVIDGETCLLDILDTAG
QEEYSAMRDQYMRTGEGFLCVFAINNAKSFEDIHQYREQIKRVKDSDDVPMVLVGNKCDL
AARTVESRQAQDLARSYGIPYIETSAKTRQGVEDAFYTLVREIRQHKARKLSPPDEGGPG
CLSCRCLLS
NT seq 570 nt   +upstreamnt  +downstreamnt
atgacggagtataagctcgtggtggtgggcgctggaggcgtagggaagagcgccctgacc
atccagctcatccagaaccactttgtggacgagtacgaccccaccatagaggactcctac
cggaagcaagtggtcatcgatggggagacctgcctgctggacatcctggacacggcgggc
caggaggagtacagcgccatgcgggaccagtacatgcgcaccggggagggcttcctttgt
gtgtttgccatcaacaatgccaagtccttcgaggacatccaccagtacagggagcagatc
aaacgggtgaaggactcggacgatgtgcccatggtgctggtggggaacaagtgtgacctg
gccgcgcgcaccgtggagtctcggcaggcccaggacctcgcccgcagctacggcatcccc
tatatcgagacgtcggccaagacgcgccagggcgtggaggatgccttctacacgctggtg
cgcgagatccggcagcacaaggcgcgcaagctgagcccgcctgacgagggcggcccgggc
tgcctgagctgcaggtgcctgctctcctga

DBGET integrated database retrieval system