KEGG   Physeter catodon (sperm whale): 102977392
Entry
102977392         CDS       T06011                                 

Gene name
PDPK1
Definition
(RefSeq) 3-phosphoinositide-dependent protein kinase 1 isoform X1
  KO
K06276  3-phosphoinositide dependent protein kinase-1 [EC:2.7.11.1]
Organism
pcad  Physeter catodon (sperm whale)
Pathway
pcad01524  Platinum drug resistance
pcad03320  PPAR signaling pathway
pcad04068  FoxO signaling pathway
pcad04071  Sphingolipid signaling pathway
pcad04140  Autophagy - animal
pcad04150  mTOR signaling pathway
pcad04151  PI3K-Akt signaling pathway
pcad04152  AMPK signaling pathway
pcad04210  Apoptosis
pcad04510  Focal adhesion
pcad04660  T cell receptor signaling pathway
pcad04664  Fc epsilon RI signaling pathway
pcad04722  Neurotrophin signaling pathway
pcad04910  Insulin signaling pathway
pcad04919  Thyroid hormone signaling pathway
pcad04931  Insulin resistance
pcad04960  Aldosterone-regulated sodium reabsorption
pcad05145  Toxoplasmosis
pcad05205  Proteoglycans in cancer
pcad05213  Endometrial cancer
pcad05215  Prostate cancer
pcad05223  Non-small cell lung cancer
pcad05231  Choline metabolism in cancer
Brite
KEGG Orthology (KO) [BR:pcad00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04068 FoxO signaling pathway
    102977392 (PDPK1)
   04071 Sphingolipid signaling pathway
    102977392 (PDPK1)
   04151 PI3K-Akt signaling pathway
    102977392 (PDPK1)
   04152 AMPK signaling pathway
    102977392 (PDPK1)
   04150 mTOR signaling pathway
    102977392 (PDPK1)
 09140 Cellular Processes
  09141 Transport and catabolism
   04140 Autophagy - animal
    102977392 (PDPK1)
  09143 Cell growth and death
   04210 Apoptosis
    102977392 (PDPK1)
  09144 Cellular community - eukaryotes
   04510 Focal adhesion
    102977392 (PDPK1)
 09150 Organismal Systems
  09151 Immune system
   04660 T cell receptor signaling pathway
    102977392 (PDPK1)
   04664 Fc epsilon RI signaling pathway
    102977392 (PDPK1)
  09152 Endocrine system
   04910 Insulin signaling pathway
    102977392 (PDPK1)
   03320 PPAR signaling pathway
    102977392 (PDPK1)
   04919 Thyroid hormone signaling pathway
    102977392 (PDPK1)
  09155 Excretory system
   04960 Aldosterone-regulated sodium reabsorption
    102977392 (PDPK1)
  09156 Nervous system
   04722 Neurotrophin signaling pathway
    102977392 (PDPK1)
 09160 Human Diseases
  09161 Cancer: overview
   05205 Proteoglycans in cancer
    102977392 (PDPK1)
   05231 Choline metabolism in cancer
    102977392 (PDPK1)
  09162 Cancer: specific types
   05215 Prostate cancer
    102977392 (PDPK1)
   05213 Endometrial cancer
    102977392 (PDPK1)
   05223 Non-small cell lung cancer
    102977392 (PDPK1)
  09167 Endocrine and metabolic disease
   04931 Insulin resistance
    102977392 (PDPK1)
  09174 Infectious disease: parasitic
   05145 Toxoplasmosis
    102977392 (PDPK1)
  09176 Drug resistance: antineoplastic
   01524 Platinum drug resistance
    102977392 (PDPK1)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01001 Protein kinases [BR:pcad01001]
    102977392 (PDPK1)
  09182 Protein families: genetic information processing
   04131 Membrane trafficking [BR:pcad04131]
    102977392 (PDPK1)
Enzymes [BR:pcad01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.11  Protein-serine/threonine kinases
    2.7.11.1  non-specific serine/threonine protein kinase
     102977392 (PDPK1)
Protein kinases [BR:pcad01001]
 Serine/threonine kinases: AGC group
  PDK1 family
   102977392 (PDPK1)
Membrane trafficking [BR:pcad04131]
 Exocytosis
  Calcium ion-dependent exocytosis
   Acrosomal exocytosis proteins
    102977392 (PDPK1)
SSDB
Motif
Pfam: Pkinase PH_3 PK_Tyr_Ser-Thr Kinase-like Pkinase_fungal APH Kdo YukC
Other DBs
NCBI-GeneID: 102977392
NCBI-ProteinID: XP_028353789
UniProt: A0A455BXP6
LinkDB
Position
14
AA seq 531 aa
MVRTQTESSTAPGIPSCGSRQGPTMDSTAAESRPSANSLQHATQPPPQPRKKRPEDFKFG
KILGEGSFSTVVLARELATSREYAIKILEKRHIIKENKVPYVTRERDVMSRLDHPFFVKL
YFTFQDDEKLYFGLSYAKNGELLKYIRKIGSFDETCTRFYTAEMVSALEYLHGKGIIHRD
LKPENILLNEDMHIQITDFGTAKVLSPESKQARANSFVGTAQYVSPELLTEKSACKSSDL
WALGCIIYQLVAGLPPFRAGNEYLIFQKIIKLEYDFPEKFFPKARDLVEKLLVLDATKRL
GCEEMEGYGPLKAHPFFESITWENLHHQTPPKLTAYLPAMSEDDEDCYGNYDNLLSQFGC
MQVSSSSSSHSLSAADAGLPQRVGSNIEQYIHDLDTNSFELDLQFSEDEKRLLLEKQASG
NPWHQFVENNLILKMGPVDKRKGLFARRRQLLLTEGPHLYYVDPVNKVLKGEIPWSQELR
PEAKNFKTFFVHTPNRTYYLMDPSGNAHKWCKKIQEVWRHRYQSHPDAAVQ
NT seq 1596 nt   +upstreamnt  +downstreamnt
atggtgaggacccagactgagtccagcacggcccctggcattcccagctgtggtagcagg
cagggccccaccatggacagcaccgcggccgaatcccggccaagcgccaactcgctgcaa
cacgccacacagccaccaccacagcctcggaagaaacggccagaagactttaaatttggg
aaaattcttggtgaaggctctttttcaacagttgtcctggcccgagaactggcaacctca
agggaatatgctattaaaattctagagaaacgtcacattatcaaagagaacaaagtcccg
tatgtaaccagagagagagacgtgatgtcgcggctggatcaccccttctttgttaaactt
tacttcacatttcaggatgatgaaaagctctattttggccttagttatgccaaaaatgga
gaactacttaaatacattcggaaaattggttcgttcgatgagacatgcacccgattttac
acagctgagatggtgtctgccctagagtacttgcatggcaagggcatcattcacagggac
ctgaaaccagaaaatattttgttaaatgaagatatgcacatccagatcacagattttgga
acagcaaaagtattatccccagagagtaaacaagccagggccaactcgtttgtaggaaca
gcccagtatgtttctccagagctgctcacagagaaatcggcctgtaaaagttcagacctt
tgggctcttggatgcataatataccagcttgtggcaggactgccaccgttccgagctgga
aatgaatatcttatatttcagaagatcattaagttggaatatgactttcctgaaaaattc
tttcctaaggcaagagatcttgtggaaaaacttctggttttagatgccacaaagcgatta
ggctgtgaagaaatggaagggtacggccctctgaaagctcatccgttctttgagtccatc
acgtgggagaacctgcatcaccagacgcctccgaagctcacagcttacttaccggccatg
tcggaagatgatgaggactgctacggcaattacgacaatctcctgagccagttcggctgc
atgcaggtgtcgtcgtcctcctcctcccactccctgtccgccgcggacgcggggctgccc
cagagggtgggaagcaacatcgagcagtatatccacgacctggacactaattcttttgaa
ctggacttacagttttctgaagatgagaagaggttgttattggagaagcaggccagcgga
aacccttggcaccagtttgtagaaaataatttaatactaaaaatgggtccagtagacaag
cgcaagggtttatttgcacggcgacgacagttactgctcacagaagggccacacttatat
tatgtagatcctgtcaacaaagtcttgaaaggtgaaattccatggtcacaagaactccgg
ccagaggccaagaattttaaaaccttctttgtccacacgccgaataggacctattacctg
atggacccgagtgggaatgctcacaaatggtgcaaaaagatccaggaggtgtggaggcac
agataccagagccacccggacgctgccgtgcagtga

DBGET integrated database retrieval system