KEGG   Physeter catodon (sperm whale): 102977417
Entry
102977417         CDS       T06011                                 

Gene name
MAPK9
Definition
(RefSeq) mitogen-activated protein kinase 9 isoform X1
  KO
K04440  mitogen-activated protein kinase 8/9/10 (c-Jun N-terminal kinase) [EC:2.7.11.24]
Organism
pcad  Physeter catodon (sperm whale)
Pathway
pcad01522  Endocrine resistance
pcad04010  MAPK signaling pathway
pcad04012  ErbB signaling pathway
pcad04014  Ras signaling pathway
pcad04024  cAMP signaling pathway
pcad04068  FoxO signaling pathway
pcad04071  Sphingolipid signaling pathway
pcad04137  Mitophagy - animal
pcad04140  Autophagy - animal
pcad04141  Protein processing in endoplasmic reticulum
pcad04210  Apoptosis
pcad04215  Apoptosis - multiple species
pcad04217  Necroptosis
pcad04310  Wnt signaling pathway
pcad04380  Osteoclast differentiation
pcad04510  Focal adhesion
pcad04530  Tight junction
pcad04620  Toll-like receptor signaling pathway
pcad04621  NOD-like receptor signaling pathway
pcad04622  RIG-I-like receptor signaling pathway
pcad04625  C-type lectin receptor signaling pathway
pcad04657  IL-17 signaling pathway
pcad04658  Th1 and Th2 cell differentiation
pcad04659  Th17 cell differentiation
pcad04660  T cell receptor signaling pathway
pcad04664  Fc epsilon RI signaling pathway
pcad04668  TNF signaling pathway
pcad04722  Neurotrophin signaling pathway
pcad04723  Retrograde endocannabinoid signaling
pcad04728  Dopaminergic synapse
pcad04750  Inflammatory mediator regulation of TRP channels
pcad04910  Insulin signaling pathway
pcad04912  GnRH signaling pathway
pcad04914  Progesterone-mediated oocyte maturation
pcad04917  Prolactin signaling pathway
pcad04920  Adipocytokine signaling pathway
pcad04926  Relaxin signaling pathway
pcad04930  Type II diabetes mellitus
pcad04931  Insulin resistance
pcad04932  Non-alcoholic fatty liver disease
pcad04933  AGE-RAGE signaling pathway in diabetic complications
pcad04935  Growth hormone synthesis, secretion and action
pcad05010  Alzheimer disease
pcad05012  Parkinson disease
pcad05016  Huntington disease
pcad05017  Spinocerebellar ataxia
pcad05020  Prion disease
pcad05022  Pathways of neurodegeneration - multiple diseases
pcad05132  Salmonella infection
pcad05133  Pertussis
pcad05135  Yersinia infection
pcad05142  Chagas disease
pcad05145  Toxoplasmosis
pcad05152  Tuberculosis
pcad05161  Hepatitis B
pcad05162  Measles
pcad05166  Human T-cell leukemia virus 1 infection
pcad05167  Kaposi sarcoma-associated herpesvirus infection
pcad05169  Epstein-Barr virus infection
pcad05170  Human immunodeficiency virus 1 infection
pcad05171  Coronavirus disease - COVID-19
pcad05200  Pathways in cancer
pcad05210  Colorectal cancer
pcad05212  Pancreatic cancer
pcad05231  Choline metabolism in cancer
pcad05418  Fluid shear stress and atherosclerosis
Brite
KEGG Orthology (KO) [BR:pcad00001]
 09120 Genetic Information Processing
  09123 Folding, sorting and degradation
   04141 Protein processing in endoplasmic reticulum
    102977417 (MAPK9)
 09130 Environmental Information Processing
  09132 Signal transduction
   04010 MAPK signaling pathway
    102977417 (MAPK9)
   04012 ErbB signaling pathway
    102977417 (MAPK9)
   04014 Ras signaling pathway
    102977417 (MAPK9)
   04310 Wnt signaling pathway
    102977417 (MAPK9)
   04668 TNF signaling pathway
    102977417 (MAPK9)
   04068 FoxO signaling pathway
    102977417 (MAPK9)
   04071 Sphingolipid signaling pathway
    102977417 (MAPK9)
   04024 cAMP signaling pathway
    102977417 (MAPK9)
 09140 Cellular Processes
  09141 Transport and catabolism
   04140 Autophagy - animal
    102977417 (MAPK9)
   04137 Mitophagy - animal
    102977417 (MAPK9)
  09143 Cell growth and death
   04210 Apoptosis
    102977417 (MAPK9)
   04215 Apoptosis - multiple species
    102977417 (MAPK9)
   04217 Necroptosis
    102977417 (MAPK9)
  09144 Cellular community - eukaryotes
   04510 Focal adhesion
    102977417 (MAPK9)
   04530 Tight junction
    102977417 (MAPK9)
 09150 Organismal Systems
  09151 Immune system
   04620 Toll-like receptor signaling pathway
    102977417 (MAPK9)
   04621 NOD-like receptor signaling pathway
    102977417 (MAPK9)
   04622 RIG-I-like receptor signaling pathway
    102977417 (MAPK9)
   04625 C-type lectin receptor signaling pathway
    102977417 (MAPK9)
   04660 T cell receptor signaling pathway
    102977417 (MAPK9)
   04658 Th1 and Th2 cell differentiation
    102977417 (MAPK9)
   04659 Th17 cell differentiation
    102977417 (MAPK9)
   04657 IL-17 signaling pathway
    102977417 (MAPK9)
   04664 Fc epsilon RI signaling pathway
    102977417 (MAPK9)
  09152 Endocrine system
   04910 Insulin signaling pathway
    102977417 (MAPK9)
   04920 Adipocytokine signaling pathway
    102977417 (MAPK9)
   04912 GnRH signaling pathway
    102977417 (MAPK9)
   04914 Progesterone-mediated oocyte maturation
    102977417 (MAPK9)
   04917 Prolactin signaling pathway
    102977417 (MAPK9)
   04926 Relaxin signaling pathway
    102977417 (MAPK9)
   04935 Growth hormone synthesis, secretion and action
    102977417 (MAPK9)
  09156 Nervous system
   04728 Dopaminergic synapse
    102977417 (MAPK9)
   04723 Retrograde endocannabinoid signaling
    102977417 (MAPK9)
   04722 Neurotrophin signaling pathway
    102977417 (MAPK9)
  09157 Sensory system
   04750 Inflammatory mediator regulation of TRP channels
    102977417 (MAPK9)
  09158 Development and regeneration
   04380 Osteoclast differentiation
    102977417 (MAPK9)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    102977417 (MAPK9)
   05231 Choline metabolism in cancer
    102977417 (MAPK9)
  09162 Cancer: specific types
   05210 Colorectal cancer
    102977417 (MAPK9)
   05212 Pancreatic cancer
    102977417 (MAPK9)
  09164 Neurodegenerative disease
   05010 Alzheimer disease
    102977417 (MAPK9)
   05012 Parkinson disease
    102977417 (MAPK9)
   05016 Huntington disease
    102977417 (MAPK9)
   05017 Spinocerebellar ataxia
    102977417 (MAPK9)
   05020 Prion disease
    102977417 (MAPK9)
   05022 Pathways of neurodegeneration - multiple diseases
    102977417 (MAPK9)
  09166 Cardiovascular disease
   05418 Fluid shear stress and atherosclerosis
    102977417 (MAPK9)
  09167 Endocrine and metabolic disease
   04930 Type II diabetes mellitus
    102977417 (MAPK9)
   04932 Non-alcoholic fatty liver disease
    102977417 (MAPK9)
   04931 Insulin resistance
    102977417 (MAPK9)
   04933 AGE-RAGE signaling pathway in diabetic complications
    102977417 (MAPK9)
  09171 Infectious disease: bacterial
   05132 Salmonella infection
    102977417 (MAPK9)
   05135 Yersinia infection
    102977417 (MAPK9)
   05133 Pertussis
    102977417 (MAPK9)
   05152 Tuberculosis
    102977417 (MAPK9)
  09172 Infectious disease: viral
   05166 Human T-cell leukemia virus 1 infection
    102977417 (MAPK9)
   05170 Human immunodeficiency virus 1 infection
    102977417 (MAPK9)
   05161 Hepatitis B
    102977417 (MAPK9)
   05171 Coronavirus disease - COVID-19
    102977417 (MAPK9)
   05162 Measles
    102977417 (MAPK9)
   05167 Kaposi sarcoma-associated herpesvirus infection
    102977417 (MAPK9)
   05169 Epstein-Barr virus infection
    102977417 (MAPK9)
  09174 Infectious disease: parasitic
   05145 Toxoplasmosis
    102977417 (MAPK9)
   05142 Chagas disease
    102977417 (MAPK9)
  09176 Drug resistance: antineoplastic
   01522 Endocrine resistance
    102977417 (MAPK9)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01001 Protein kinases [BR:pcad01001]
    102977417 (MAPK9)
Enzymes [BR:pcad01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.11  Protein-serine/threonine kinases
    2.7.11.24  mitogen-activated protein kinase
     102977417 (MAPK9)
Protein kinases [BR:pcad01001]
 Serine/threonine kinases: CMGC group
  MAPK family [OT]
   102977417 (MAPK9)
SSDB
Motif
Pfam: Pkinase PK_Tyr_Ser-Thr Kdo Kinase-like RIO1 APH FTA2
Other DBs
NCBI-GeneID: 102977417
NCBI-ProteinID: XP_023972057
UniProt: A0A2Y9S3T8
LinkDB
Position
2
AA seq 424 aa
MSDSKCDSQFYSVQVADSTFSVLKRYQQLKPIGSGAQGIVCAAFDTVLGINVAVKKLSRP
FQNQTHAKRAYRELVLLKCVNHKNIISLLNVFTPQKTLEEFQDVYLVMELMDANLCQVIH
MELDHERMSYLLYQMLCGIKHLHSAGIIHRDLKPSNIVVKSDCTLKILDFGLARTACTNF
MMTPYVVTRYYRAPEVILGMGYKENVDIWSVGCIMGELVKGCVIFQGTDHIDQWNKVIEQ
LGTPSADFMKKLQPTVRNYVENRPKYPGIKFEELFPDWIFPSESERDKIKTSQARDLLSK
MLVIDPDKRISVDEALRHPYITVWYDPAEAEAPPPQIYDAQLEEREHAIEEWKELIYKEV
MDWEERSKNGVVKDQPSDAAVSSNATPSQSSSINDISSMSTEQTLASDTDSSLDASTGPL
EGCR
NT seq 1275 nt   +upstreamnt  +downstreamnt
atgagtgacagtaaatgtgatagtcagttttacagtgtacaagtggcagactcaactttc
tctgtcctaaaacgttaccagcagttgaaaccaattggctctggagcccaaggaattgtc
tgtgctgcttttgatacagttcttgggataaatgttgcagtcaagaaactaagccgtcct
tttcagaatcagactcatgcaaagagagcttatcgtgaacttgtcctcttaaaatgtgtc
aatcataaaaatataattagtttgttaaatgtgtttacaccacaaaaaactctagaagaa
tttcaagatgtgtatttggttatggaattaatggatgctaacttatgtcaggttattcat
atggagttggaccatgaaagaatgtcctaccttctttaccagatgctctgtggtattaaa
catctacattcagctggtataattcatagagatttgaaacctagcaacattgtagtaaag
tcagactgtacccttaagatccttgactttggcctggctcgcacagcatgcaccaacttt
atgatgaccccctacgtggtaacgcggtattatcgggcacctgaagtcatcctgggcatg
ggctacaaagagaacgttgatatctggtcagtgggttgcatcatgggagagctggtgaaa
ggttgtgtgatattccaaggcactgatcatattgatcagtggaataaagttattgagcag
ctaggaacaccatctgcagatttcatgaagaaacttcagccaactgtgaggaattacgta
gaaaacagaccaaagtatcctggaatcaaatttgaagaactctttccagattggatattc
ccatcagaatctgaacgagacaaaattaaaacaagtcaagccagagacttactatcaaaa
atgttagtgatagatcccgacaagcgaatctctgtagatgaagctttgcgtcacccttat
atcactgtttggtatgaccctgctgaagcagaagcgccaccacctcaaatttatgatgcc
cagttggaagaaagagaacatgcaattgaagaatggaaagagctaatttacaaagaagta
atggattgggaagaaagaagcaagaatggtgttgtgaaagatcaaccttcagatgcagca
gtaagtagcaacgccactccttctcagtcgtcatctatcaatgacatttcatccatgtcc
actgagcagacgctggcctcagacacagacagcagtctggatgcctcaacaggacccctt
gaaggttgtcgatga

KEGG   Physeter catodon (sperm whale): 102984741
Entry
102984741         CDS       T06011                                 

Gene name
MAPK10
Definition
(RefSeq) mitogen-activated protein kinase 10 isoform X1
  KO
K04440  mitogen-activated protein kinase 8/9/10 (c-Jun N-terminal kinase) [EC:2.7.11.24]
Organism
pcad  Physeter catodon (sperm whale)
Pathway
pcad01522  Endocrine resistance
pcad04010  MAPK signaling pathway
pcad04012  ErbB signaling pathway
pcad04014  Ras signaling pathway
pcad04024  cAMP signaling pathway
pcad04068  FoxO signaling pathway
pcad04071  Sphingolipid signaling pathway
pcad04137  Mitophagy - animal
pcad04140  Autophagy - animal
pcad04141  Protein processing in endoplasmic reticulum
pcad04210  Apoptosis
pcad04215  Apoptosis - multiple species
pcad04217  Necroptosis
pcad04310  Wnt signaling pathway
pcad04380  Osteoclast differentiation
pcad04510  Focal adhesion
pcad04530  Tight junction
pcad04620  Toll-like receptor signaling pathway
pcad04621  NOD-like receptor signaling pathway
pcad04622  RIG-I-like receptor signaling pathway
pcad04625  C-type lectin receptor signaling pathway
pcad04657  IL-17 signaling pathway
pcad04658  Th1 and Th2 cell differentiation
pcad04659  Th17 cell differentiation
pcad04660  T cell receptor signaling pathway
pcad04664  Fc epsilon RI signaling pathway
pcad04668  TNF signaling pathway
pcad04722  Neurotrophin signaling pathway
pcad04723  Retrograde endocannabinoid signaling
pcad04728  Dopaminergic synapse
pcad04750  Inflammatory mediator regulation of TRP channels
pcad04910  Insulin signaling pathway
pcad04912  GnRH signaling pathway
pcad04914  Progesterone-mediated oocyte maturation
pcad04917  Prolactin signaling pathway
pcad04920  Adipocytokine signaling pathway
pcad04926  Relaxin signaling pathway
pcad04930  Type II diabetes mellitus
pcad04931  Insulin resistance
pcad04932  Non-alcoholic fatty liver disease
pcad04933  AGE-RAGE signaling pathway in diabetic complications
pcad04935  Growth hormone synthesis, secretion and action
pcad05010  Alzheimer disease
pcad05012  Parkinson disease
pcad05016  Huntington disease
pcad05017  Spinocerebellar ataxia
pcad05020  Prion disease
pcad05022  Pathways of neurodegeneration - multiple diseases
pcad05132  Salmonella infection
pcad05133  Pertussis
pcad05135  Yersinia infection
pcad05142  Chagas disease
pcad05145  Toxoplasmosis
pcad05152  Tuberculosis
pcad05161  Hepatitis B
pcad05162  Measles
pcad05166  Human T-cell leukemia virus 1 infection
pcad05167  Kaposi sarcoma-associated herpesvirus infection
pcad05169  Epstein-Barr virus infection
pcad05170  Human immunodeficiency virus 1 infection
pcad05171  Coronavirus disease - COVID-19
pcad05200  Pathways in cancer
pcad05210  Colorectal cancer
pcad05212  Pancreatic cancer
pcad05231  Choline metabolism in cancer
pcad05418  Fluid shear stress and atherosclerosis
Brite
KEGG Orthology (KO) [BR:pcad00001]
 09120 Genetic Information Processing
  09123 Folding, sorting and degradation
   04141 Protein processing in endoplasmic reticulum
    102984741 (MAPK10)
 09130 Environmental Information Processing
  09132 Signal transduction
   04010 MAPK signaling pathway
    102984741 (MAPK10)
   04012 ErbB signaling pathway
    102984741 (MAPK10)
   04014 Ras signaling pathway
    102984741 (MAPK10)
   04310 Wnt signaling pathway
    102984741 (MAPK10)
   04668 TNF signaling pathway
    102984741 (MAPK10)
   04068 FoxO signaling pathway
    102984741 (MAPK10)
   04071 Sphingolipid signaling pathway
    102984741 (MAPK10)
   04024 cAMP signaling pathway
    102984741 (MAPK10)
 09140 Cellular Processes
  09141 Transport and catabolism
   04140 Autophagy - animal
    102984741 (MAPK10)
   04137 Mitophagy - animal
    102984741 (MAPK10)
  09143 Cell growth and death
   04210 Apoptosis
    102984741 (MAPK10)
   04215 Apoptosis - multiple species
    102984741 (MAPK10)
   04217 Necroptosis
    102984741 (MAPK10)
  09144 Cellular community - eukaryotes
   04510 Focal adhesion
    102984741 (MAPK10)
   04530 Tight junction
    102984741 (MAPK10)
 09150 Organismal Systems
  09151 Immune system
   04620 Toll-like receptor signaling pathway
    102984741 (MAPK10)
   04621 NOD-like receptor signaling pathway
    102984741 (MAPK10)
   04622 RIG-I-like receptor signaling pathway
    102984741 (MAPK10)
   04625 C-type lectin receptor signaling pathway
    102984741 (MAPK10)
   04660 T cell receptor signaling pathway
    102984741 (MAPK10)
   04658 Th1 and Th2 cell differentiation
    102984741 (MAPK10)
   04659 Th17 cell differentiation
    102984741 (MAPK10)
   04657 IL-17 signaling pathway
    102984741 (MAPK10)
   04664 Fc epsilon RI signaling pathway
    102984741 (MAPK10)
  09152 Endocrine system
   04910 Insulin signaling pathway
    102984741 (MAPK10)
   04920 Adipocytokine signaling pathway
    102984741 (MAPK10)
   04912 GnRH signaling pathway
    102984741 (MAPK10)
   04914 Progesterone-mediated oocyte maturation
    102984741 (MAPK10)
   04917 Prolactin signaling pathway
    102984741 (MAPK10)
   04926 Relaxin signaling pathway
    102984741 (MAPK10)
   04935 Growth hormone synthesis, secretion and action
    102984741 (MAPK10)
  09156 Nervous system
   04728 Dopaminergic synapse
    102984741 (MAPK10)
   04723 Retrograde endocannabinoid signaling
    102984741 (MAPK10)
   04722 Neurotrophin signaling pathway
    102984741 (MAPK10)
  09157 Sensory system
   04750 Inflammatory mediator regulation of TRP channels
    102984741 (MAPK10)
  09158 Development and regeneration
   04380 Osteoclast differentiation
    102984741 (MAPK10)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    102984741 (MAPK10)
   05231 Choline metabolism in cancer
    102984741 (MAPK10)
  09162 Cancer: specific types
   05210 Colorectal cancer
    102984741 (MAPK10)
   05212 Pancreatic cancer
    102984741 (MAPK10)
  09164 Neurodegenerative disease
   05010 Alzheimer disease
    102984741 (MAPK10)
   05012 Parkinson disease
    102984741 (MAPK10)
   05016 Huntington disease
    102984741 (MAPK10)
   05017 Spinocerebellar ataxia
    102984741 (MAPK10)
   05020 Prion disease
    102984741 (MAPK10)
   05022 Pathways of neurodegeneration - multiple diseases
    102984741 (MAPK10)
  09166 Cardiovascular disease
   05418 Fluid shear stress and atherosclerosis
    102984741 (MAPK10)
  09167 Endocrine and metabolic disease
   04930 Type II diabetes mellitus
    102984741 (MAPK10)
   04932 Non-alcoholic fatty liver disease
    102984741 (MAPK10)
   04931 Insulin resistance
    102984741 (MAPK10)
   04933 AGE-RAGE signaling pathway in diabetic complications
    102984741 (MAPK10)
  09171 Infectious disease: bacterial
   05132 Salmonella infection
    102984741 (MAPK10)
   05135 Yersinia infection
    102984741 (MAPK10)
   05133 Pertussis
    102984741 (MAPK10)
   05152 Tuberculosis
    102984741 (MAPK10)
  09172 Infectious disease: viral
   05166 Human T-cell leukemia virus 1 infection
    102984741 (MAPK10)
   05170 Human immunodeficiency virus 1 infection
    102984741 (MAPK10)
   05161 Hepatitis B
    102984741 (MAPK10)
   05171 Coronavirus disease - COVID-19
    102984741 (MAPK10)
   05162 Measles
    102984741 (MAPK10)
   05167 Kaposi sarcoma-associated herpesvirus infection
    102984741 (MAPK10)
   05169 Epstein-Barr virus infection
    102984741 (MAPK10)
  09174 Infectious disease: parasitic
   05145 Toxoplasmosis
    102984741 (MAPK10)
   05142 Chagas disease
    102984741 (MAPK10)
  09176 Drug resistance: antineoplastic
   01522 Endocrine resistance
    102984741 (MAPK10)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01001 Protein kinases [BR:pcad01001]
    102984741 (MAPK10)
Enzymes [BR:pcad01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.11  Protein-serine/threonine kinases
    2.7.11.24  mitogen-activated protein kinase
     102984741 (MAPK10)
Protein kinases [BR:pcad01001]
 Serine/threonine kinases: CMGC group
  MAPK family [OT]
   102984741 (MAPK10)
SSDB
Motif
Pfam: Pkinase PK_Tyr_Ser-Thr Kdo Kinase-like RIO1 APH FTA2
Other DBs
NCBI-GeneID: 102984741
NCBI-ProteinID: XP_023972633
UniProt: A0A2Y9S232
LinkDB
Position
7
AA seq 464 aa
MSLHLLYYCSEPTLDVKIAFCQGFDKQVDVSYIAKHYNMSKSKVDNQFYSVEVGDSTFTV
LKRYQNLKPIGSGAQGIVCAAYDAVLDRNVAIKKLSRPFQNQTHAKRAYRELVLMKCVNH
KNIISLLNVFTPQKTLEEFQDVYLVMELMDANLCQVIQMELDHERMSYLLYQMLCGIKHL
HSAGIIHRDLKPSNIVVKSDCTLKILDFGLARTAGTSFMMTPYVVTRYYRAPEVILGMGY
KENVDIWSVGCIMGEMVRHKILFPGRDYIDQWNKVIEQLGTPCPEFMKKLQPTVRNYVEN
RPKYAGLTFPKLFPDSLFPADSEHNKLKASQARDLLSKMLVIDPAKRISVDDALQHPYIN
VWYDPAEVEAPPPQIYDKQLDEREHTIEEWKELIYKEVMNSEEKTKNGVVKGQPSPSGAA
VNSSESLPPSSSVNDISSMSTDQTLASDTDSSLEASAGPLGCCR
NT seq 1395 nt   +upstreamnt  +downstreamnt
atgagcctccatttattgtactactgcagtgaaccaaccttggatgtgaaaattgccttt
tgtcagggattcgataaacaagtggatgtgtcatatattgccaaacattacaacatgagc
aaaagcaaagttgacaaccagttctacagcgtggaagtgggagactcaaccttcacagtt
ctcaagcgctaccagaatctaaagcctattggctctggggctcagggaatagtttgtgct
gcgtatgatgctgttcttgacagaaatgtggccattaagaagctcagcagaccctttcag
aaccaaacgcatgccaagagagcttaccgggagctggtcctcatgaagtgtgtgaaccat
aaaaacattattagtttattaaatgtcttcacaccccagaaaacgctggaggagttccaa
gatgtttacttagtaatggaactgatggatgccaacttgtgtcaggtgattcagatggag
ttagaccacgagcgaatgtcttacctgctataccaaatgttgtgtggcatcaagcacctt
cactctgctggaattattcacagggacttgaaaccaagtaacattgtagtcaagtctgat
tgtacattgaaaatcctagactttggactggccaggacagcaggcacaagcttcatgatg
actccttatgtggtgacacgttattacagggcccccgaggttattctgggaatgggctac
aaggagaacgtggatatatggtctgtgggatgcattatgggagaaatggttcgccacaaa
atcctctttccaggaagggactatattgaccagtggaacaaggtaattgagcaactagga
acaccatgtccagagttcatgaagaaattgcaacccacagtaagaaactatgtggagaat
cggcccaagtacgcaggactcaccttccccaagctctttccagattcccttttcccagcg
gactccgagcacaataaactcaaagccagccaagccagggacttgttgtcaaagatgcta
gtgattgacccagcaaaaaggatatcagtggacgacgccttacagcatccgtacatcaat
gtgtggtatgatcctgccgaagtggaggcgcccccaccccagatatacgacaaacagctg
gatgaaagagaacacaccattgaagaatggaaagaacttatttacaaggaagtcatgaat
tcagaagaaaagactaagaacggcgttgtgaaaggacagccttctccttcaggtgcagca
gtgaacagcagtgagagtctccctccatcctcatctgtcaacgatatctcctccatgtcc
accgaccagaccctggcatctgacactgacagcagcctggaagcctcggcaggacccctg
ggttgctgcaggtga

KEGG   Physeter catodon (sperm whale): 102996353
Entry
102996353         CDS       T06011                                 

Gene name
MAPK8
Definition
(RefSeq) mitogen-activated protein kinase 8 isoform X3
  KO
K04440  mitogen-activated protein kinase 8/9/10 (c-Jun N-terminal kinase) [EC:2.7.11.24]
Organism
pcad  Physeter catodon (sperm whale)
Pathway
pcad01522  Endocrine resistance
pcad04010  MAPK signaling pathway
pcad04012  ErbB signaling pathway
pcad04014  Ras signaling pathway
pcad04024  cAMP signaling pathway
pcad04068  FoxO signaling pathway
pcad04071  Sphingolipid signaling pathway
pcad04137  Mitophagy - animal
pcad04140  Autophagy - animal
pcad04141  Protein processing in endoplasmic reticulum
pcad04210  Apoptosis
pcad04215  Apoptosis - multiple species
pcad04217  Necroptosis
pcad04310  Wnt signaling pathway
pcad04380  Osteoclast differentiation
pcad04510  Focal adhesion
pcad04530  Tight junction
pcad04620  Toll-like receptor signaling pathway
pcad04621  NOD-like receptor signaling pathway
pcad04622  RIG-I-like receptor signaling pathway
pcad04625  C-type lectin receptor signaling pathway
pcad04657  IL-17 signaling pathway
pcad04658  Th1 and Th2 cell differentiation
pcad04659  Th17 cell differentiation
pcad04660  T cell receptor signaling pathway
pcad04664  Fc epsilon RI signaling pathway
pcad04668  TNF signaling pathway
pcad04722  Neurotrophin signaling pathway
pcad04723  Retrograde endocannabinoid signaling
pcad04728  Dopaminergic synapse
pcad04750  Inflammatory mediator regulation of TRP channels
pcad04910  Insulin signaling pathway
pcad04912  GnRH signaling pathway
pcad04914  Progesterone-mediated oocyte maturation
pcad04917  Prolactin signaling pathway
pcad04920  Adipocytokine signaling pathway
pcad04926  Relaxin signaling pathway
pcad04930  Type II diabetes mellitus
pcad04931  Insulin resistance
pcad04932  Non-alcoholic fatty liver disease
pcad04933  AGE-RAGE signaling pathway in diabetic complications
pcad04935  Growth hormone synthesis, secretion and action
pcad05010  Alzheimer disease
pcad05012  Parkinson disease
pcad05016  Huntington disease
pcad05017  Spinocerebellar ataxia
pcad05020  Prion disease
pcad05022  Pathways of neurodegeneration - multiple diseases
pcad05132  Salmonella infection
pcad05133  Pertussis
pcad05135  Yersinia infection
pcad05142  Chagas disease
pcad05145  Toxoplasmosis
pcad05152  Tuberculosis
pcad05161  Hepatitis B
pcad05162  Measles
pcad05166  Human T-cell leukemia virus 1 infection
pcad05167  Kaposi sarcoma-associated herpesvirus infection
pcad05169  Epstein-Barr virus infection
pcad05170  Human immunodeficiency virus 1 infection
pcad05171  Coronavirus disease - COVID-19
pcad05200  Pathways in cancer
pcad05210  Colorectal cancer
pcad05212  Pancreatic cancer
pcad05231  Choline metabolism in cancer
pcad05418  Fluid shear stress and atherosclerosis
Brite
KEGG Orthology (KO) [BR:pcad00001]
 09120 Genetic Information Processing
  09123 Folding, sorting and degradation
   04141 Protein processing in endoplasmic reticulum
    102996353 (MAPK8)
 09130 Environmental Information Processing
  09132 Signal transduction
   04010 MAPK signaling pathway
    102996353 (MAPK8)
   04012 ErbB signaling pathway
    102996353 (MAPK8)
   04014 Ras signaling pathway
    102996353 (MAPK8)
   04310 Wnt signaling pathway
    102996353 (MAPK8)
   04668 TNF signaling pathway
    102996353 (MAPK8)
   04068 FoxO signaling pathway
    102996353 (MAPK8)
   04071 Sphingolipid signaling pathway
    102996353 (MAPK8)
   04024 cAMP signaling pathway
    102996353 (MAPK8)
 09140 Cellular Processes
  09141 Transport and catabolism
   04140 Autophagy - animal
    102996353 (MAPK8)
   04137 Mitophagy - animal
    102996353 (MAPK8)
  09143 Cell growth and death
   04210 Apoptosis
    102996353 (MAPK8)
   04215 Apoptosis - multiple species
    102996353 (MAPK8)
   04217 Necroptosis
    102996353 (MAPK8)
  09144 Cellular community - eukaryotes
   04510 Focal adhesion
    102996353 (MAPK8)
   04530 Tight junction
    102996353 (MAPK8)
 09150 Organismal Systems
  09151 Immune system
   04620 Toll-like receptor signaling pathway
    102996353 (MAPK8)
   04621 NOD-like receptor signaling pathway
    102996353 (MAPK8)
   04622 RIG-I-like receptor signaling pathway
    102996353 (MAPK8)
   04625 C-type lectin receptor signaling pathway
    102996353 (MAPK8)
   04660 T cell receptor signaling pathway
    102996353 (MAPK8)
   04658 Th1 and Th2 cell differentiation
    102996353 (MAPK8)
   04659 Th17 cell differentiation
    102996353 (MAPK8)
   04657 IL-17 signaling pathway
    102996353 (MAPK8)
   04664 Fc epsilon RI signaling pathway
    102996353 (MAPK8)
  09152 Endocrine system
   04910 Insulin signaling pathway
    102996353 (MAPK8)
   04920 Adipocytokine signaling pathway
    102996353 (MAPK8)
   04912 GnRH signaling pathway
    102996353 (MAPK8)
   04914 Progesterone-mediated oocyte maturation
    102996353 (MAPK8)
   04917 Prolactin signaling pathway
    102996353 (MAPK8)
   04926 Relaxin signaling pathway
    102996353 (MAPK8)
   04935 Growth hormone synthesis, secretion and action
    102996353 (MAPK8)
  09156 Nervous system
   04728 Dopaminergic synapse
    102996353 (MAPK8)
   04723 Retrograde endocannabinoid signaling
    102996353 (MAPK8)
   04722 Neurotrophin signaling pathway
    102996353 (MAPK8)
  09157 Sensory system
   04750 Inflammatory mediator regulation of TRP channels
    102996353 (MAPK8)
  09158 Development and regeneration
   04380 Osteoclast differentiation
    102996353 (MAPK8)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    102996353 (MAPK8)
   05231 Choline metabolism in cancer
    102996353 (MAPK8)
  09162 Cancer: specific types
   05210 Colorectal cancer
    102996353 (MAPK8)
   05212 Pancreatic cancer
    102996353 (MAPK8)
  09164 Neurodegenerative disease
   05010 Alzheimer disease
    102996353 (MAPK8)
   05012 Parkinson disease
    102996353 (MAPK8)
   05016 Huntington disease
    102996353 (MAPK8)
   05017 Spinocerebellar ataxia
    102996353 (MAPK8)
   05020 Prion disease
    102996353 (MAPK8)
   05022 Pathways of neurodegeneration - multiple diseases
    102996353 (MAPK8)
  09166 Cardiovascular disease
   05418 Fluid shear stress and atherosclerosis
    102996353 (MAPK8)
  09167 Endocrine and metabolic disease
   04930 Type II diabetes mellitus
    102996353 (MAPK8)
   04932 Non-alcoholic fatty liver disease
    102996353 (MAPK8)
   04931 Insulin resistance
    102996353 (MAPK8)
   04933 AGE-RAGE signaling pathway in diabetic complications
    102996353 (MAPK8)
  09171 Infectious disease: bacterial
   05132 Salmonella infection
    102996353 (MAPK8)
   05135 Yersinia infection
    102996353 (MAPK8)
   05133 Pertussis
    102996353 (MAPK8)
   05152 Tuberculosis
    102996353 (MAPK8)
  09172 Infectious disease: viral
   05166 Human T-cell leukemia virus 1 infection
    102996353 (MAPK8)
   05170 Human immunodeficiency virus 1 infection
    102996353 (MAPK8)
   05161 Hepatitis B
    102996353 (MAPK8)
   05171 Coronavirus disease - COVID-19
    102996353 (MAPK8)
   05162 Measles
    102996353 (MAPK8)
   05167 Kaposi sarcoma-associated herpesvirus infection
    102996353 (MAPK8)
   05169 Epstein-Barr virus infection
    102996353 (MAPK8)
  09174 Infectious disease: parasitic
   05145 Toxoplasmosis
    102996353 (MAPK8)
   05142 Chagas disease
    102996353 (MAPK8)
  09176 Drug resistance: antineoplastic
   01522 Endocrine resistance
    102996353 (MAPK8)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01001 Protein kinases [BR:pcad01001]
    102996353 (MAPK8)
Enzymes [BR:pcad01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.11  Protein-serine/threonine kinases
    2.7.11.24  mitogen-activated protein kinase
     102996353 (MAPK8)
Protein kinases [BR:pcad01001]
 Serine/threonine kinases: CMGC group
  MAPK family [OT]
   102996353 (MAPK8)
SSDB
Motif
Pfam: Pkinase PK_Tyr_Ser-Thr Kdo Kinase-like RIO1 APH FTA2
Other DBs
NCBI-GeneID: 102996353
NCBI-ProteinID: XP_007106694
UniProt: A0A2Y9EPS4
LinkDB
Position
20
AA seq 384 aa
MSRSKRDSNFYSVEIGDSTFTVLKRYQNLKPIGSGAQGIVCAAYDAILERNVAIKKLSRP
FQNQTHAKRAYRELVLMKCVNHKNIIGLLNVFTPQKSLEEFQDVYIVMELMDANLCQVIQ
MELDHERMSYLLYQMLCGIKHLHSAGIIHRDLKPSNIVVKSDCTLKILDFGLARTAGTSF
MMTPYVVTRYYRAPEVILGMGYKENVDIWSVGCIMGEMIKGGVLFPGTDHIDQWNKVIEQ
LGTPCPEFMKKLQPTVRTYVENRPKYAGYSFEKLFPDVLFPADSEHNKLKASQARDLLSK
MLVIDASKRISVDEALQHPYINVWYDPSEAEAPPPKIPDKQLDEREHTIEEWKELIYKEV
MDLEERTKNGVIRGQPSPLAQVQQ
NT seq 1155 nt   +upstreamnt  +downstreamnt
atgagcagaagcaagcgtgacagcaatttttatagtgtagagattggagattctacattc
acagtcctgaaacggtatcagaatttaaaacctataggttcaggagcccaaggaatagta
tgtgcagcttatgatgccattcttgaaagaaatgttgcaatcaagaagctaagccggcca
tttcagaatcaaactcatgctaagcgtgcttacagagagctagttcttatgaaatgtgta
aatcacaaaaatataattggccttttgaatgtttttacaccacagaaatccctagaagaa
tttcaagatgtttacatagtcatggagctcatggatgcaaatctttgtcaagtgattcag
atggaactagatcatgaaagaatgtcctaccttctctatcagatgctgtgtggaatcaag
caccttcactctgctggaattattcatcgggacttaaagcccagtaatatagtagtaaaa
tcagactgcactttgaagattcttgactttggactggccaggactgcaggaactagtttt
atgatgacaccttacgtagtgactcgctactacagagcacctgaggtcatcctagggatg
ggctacaaagaaaacgttgacatttggtcagttgggtgcatcatgggagaaatgatcaaa
ggtggtgttttgttcccaggtactgatcatattgatcagtggaataaagttattgaacag
cttggaacaccatgtcctgaattcatgaagaaactacaaccaacagtaaggacttatgtt
gaaaacagacctaaatatgctggatatagctttgagaaactcttccctgatgtacttttc
ccagctgactcggaacacaacaaacttaaagccagtcaggcaagggatttgttatccaaa
atgctggtaattgatgcatctaaaaggatttctgtagatgaagctctccagcacccatat
atcaatgtctggtatgatccttctgaagcagaagctccaccaccaaagatacctgacaag
cagttagatgaaagggaacacacaatagaagagtggaaagaattgatatacaaagaagtt
atggacttggaggagagaaccaagaatggagttatacgggggcaaccctctcctttagca
caggtgcagcagtga

DBGET integrated database retrieval system