KEGG   Physeter catodon (sperm whale): 102977431
Entry
102977431         CDS       T06011                                 

Gene name
EGF
Definition
(RefSeq) pro-epidermal growth factor isoform X1
  KO
K04357  epidermal growth factor
Organism
pcad  Physeter catodon (sperm whale)
Pathway
pcad01521  EGFR tyrosine kinase inhibitor resistance
pcad04010  MAPK signaling pathway
pcad04012  ErbB signaling pathway
pcad04014  Ras signaling pathway
pcad04015  Rap1 signaling pathway
pcad04020  Calcium signaling pathway
pcad04066  HIF-1 signaling pathway
pcad04068  FoxO signaling pathway
pcad04072  Phospholipase D signaling pathway
pcad04151  PI3K-Akt signaling pathway
pcad04510  Focal adhesion
pcad04540  Gap junction
pcad04630  JAK-STAT signaling pathway
pcad04810  Regulation of actin cytoskeleton
pcad05160  Hepatitis C
pcad05165  Human papillomavirus infection
pcad05200  Pathways in cancer
pcad05210  Colorectal cancer
pcad05212  Pancreatic cancer
pcad05213  Endometrial cancer
pcad05214  Glioma
pcad05215  Prostate cancer
pcad05218  Melanoma
pcad05219  Bladder cancer
pcad05223  Non-small cell lung cancer
pcad05224  Breast cancer
pcad05226  Gastric cancer
pcad05231  Choline metabolism in cancer
pcad05235  PD-L1 expression and PD-1 checkpoint pathway in cancer
Brite
KEGG Orthology (KO) [BR:pcad00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04010 MAPK signaling pathway
    102977431 (EGF)
   04012 ErbB signaling pathway
    102977431 (EGF)
   04014 Ras signaling pathway
    102977431 (EGF)
   04015 Rap1 signaling pathway
    102977431 (EGF)
   04630 JAK-STAT signaling pathway
    102977431 (EGF)
   04066 HIF-1 signaling pathway
    102977431 (EGF)
   04068 FoxO signaling pathway
    102977431 (EGF)
   04020 Calcium signaling pathway
    102977431 (EGF)
   04072 Phospholipase D signaling pathway
    102977431 (EGF)
   04151 PI3K-Akt signaling pathway
    102977431 (EGF)
 09140 Cellular Processes
  09144 Cellular community - eukaryotes
   04510 Focal adhesion
    102977431 (EGF)
   04540 Gap junction
    102977431 (EGF)
  09142 Cell motility
   04810 Regulation of actin cytoskeleton
    102977431 (EGF)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    102977431 (EGF)
   05231 Choline metabolism in cancer
    102977431 (EGF)
   05235 PD-L1 expression and PD-1 checkpoint pathway in cancer
    102977431 (EGF)
  09162 Cancer: specific types
   05210 Colorectal cancer
    102977431 (EGF)
   05212 Pancreatic cancer
    102977431 (EGF)
   05226 Gastric cancer
    102977431 (EGF)
   05214 Glioma
    102977431 (EGF)
   05218 Melanoma
    102977431 (EGF)
   05219 Bladder cancer
    102977431 (EGF)
   05215 Prostate cancer
    102977431 (EGF)
   05213 Endometrial cancer
    102977431 (EGF)
   05224 Breast cancer
    102977431 (EGF)
   05223 Non-small cell lung cancer
    102977431 (EGF)
  09172 Infectious disease: viral
   05160 Hepatitis C
    102977431 (EGF)
   05165 Human papillomavirus infection
    102977431 (EGF)
  09176 Drug resistance: antineoplastic
   01521 EGFR tyrosine kinase inhibitor resistance
    102977431 (EGF)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04052 Cytokines and growth factors [BR:pcad04052]
    102977431 (EGF)
Cytokines and growth factors [BR:pcad04052]
 Growth factors
  Growth factors (RTK binding)
   102977431 (EGF)
SSDB
Motif
Pfam: Ldl_recept_b FXa_inhibition cEGF EGF_CA EGF DUF5050 EGF_3 Plasmod_Pvs28
Other DBs
NCBI-GeneID: 102977431
NCBI-ProteinID: XP_007105913
UniProt: A0A2Y9EPM1
LinkDB
Position
7
AA seq 1214 aa
MLLSLIILLPVVFKFSFVSLSALQRWSCPEGSPSRNGNSTCVGPAPFLIFSHGNRIFRID
LEGTNHEQLVADAGTSMIMDFHYNEERIYWVDLERRLLQRVFLNGTSQEKICEIEKNVSG
MAINWINEELIWSNQQEGIITVTDMKGNNSRVLLSALKYPANIAVDPVERFMFWSSEVAG
SLHRADLGGVEVKLLLETSEKITAVSLDVLDKRLFWIQYHRERSNSRICSCDYDGGSVHF
SKHHTQHNFFAMSLFGDRIFYSTWQKKTIWIANKHTGKNMVKINLSPSFVPPGGIKVVHP
LVQPKAEGDPWAPDQKLCKLRKGNCRSSMCGQEPKSHVCMCAEGYALSQDGKNCEDVNEC
AFWNHGCTLGCENIPGSYYCTCPVGFVLLPDGKRCHQLISCPSNVSECSHDCVLTSDGPI
CFCPEGSVLETDGKTCSGCSSPDNGGCSQLCIPLSPVSWECGCIPGYDLQLDKKSCTASG
PPPFLLFANSQDIRHMHFDGTDYGTLLSQQIGMVFALDHDPVENKIYFAHTALKWIERAN
MDGSQRERLTEEEVGVPEGLAVDWIGRKFYWTDRGKSLIERSDLNGKYREIIIKEDISQP
RGLAVHPRAKRLFWTEMGINPRIESSSLQGIDRLVIASSDLVWPSGITIDYLTDKLYWCD
AKQSVIEMSNLDGSKRQRLAQNDVGHPFAVAVFEDHVWFSDWTMPSVIRVNKRTGKNRVR
LRGSMLKPSSLVVVHPLAKPGADACLHQNGGCEHICEERFGTAQCLCREGFVKAPDGKTC
LALNGHQILAGSEADLSNGVIPLDILPSSRELEDTITESQHMLVAEIMVSDDADCSALGC
STQAWCVSEGESVTCRCLKGFAGDGKLCSDIDECQMGISVCPPTSSKCVNTEGGHVCRCS
EGYQGDGIHCLDIDECQLGVHACGENAACTNTEGNYTCTCAGNLSEPGRICPDSTPPSHP
REDGRSPVRNIYPECPPSHDGYCLHGGVCMYVEAVDSYACNCVVGYVGERCQHRDLKWWE
LRHAGPGRQRSISAVVACVVVLILLLCLGLCGAQKYRTQKLLSKNPKNPYEDSSRDVSSV
RPADDEAGLSSCRQPWFVVIKEHQNFCNGSQPVALKDGLVADVGQFSSLEPGSLQPTSWR
KEPQMYMGTEQGCCVSSSSDKGSSHQRMKCSFHLPSYGAWPIAGGVEKSHSLPSACPLWQ
QRAPDPPHQMELTQ
NT seq 3645 nt   +upstreamnt  +downstreamnt
atgctgctgtcccttatcattctgttgccggtagtttttaaatttagttttgttagcctc
tcagcactgcagcgctggagctgtcctgaaggctctccctcgagaaatgggaattctact
tgtgtgggtcctgcacccttcttaattttctcgcatggaaacaggatctttaggattgac
ttagaaggaactaatcatgagcaattggtggcagatgctggcacatccatgatcatggat
tttcattacaatgaagaaagaatctattgggtcgatctagaaagacgacttttgcaaaga
gtttttctgaatgggacaagccaagagaaaatatgcgagatagagaaaaatgtttcagga
atggcaataaattggatcaatgaagaacttatttggtcaaatcaacaggaaggaatcatt
acagtaacagatatgaaaggaaacaattcccgtgttctcttaagcgccttaaaatatcct
gcaaatatagcagttgatccagtagaaaggtttatgttttggtcttcagaggtggccggc
agccttcacagagcagatctcggtggtgtggaagtgaagcttctgttagagacatcagag
aaaataacagctgtgtcattggatgtgcttgataaacggctcttttggattcagtaccat
agagaaagaagcaattctcgtatttgttcctgtgattacgatggaggttctgtccatttt
agcaaacatcacacacagcacaatttttttgcgatgtccctttttggtgatcgtattttc
tattcaacatggcaaaagaagacaatttggatagctaacaagcacactgggaagaatatg
gttaaaattaacctgagtccatcatttgtaccacctggtggaattaaagtagtgcatcca
ctcgtacagcccaaggcagagggtgatccttgggcacctgatcagaaactctgcaaactg
aggaaaggtaactgcagaagcagcatgtgtgggcaagagcctaagtctcatgtgtgcatg
tgtgcagagggatatgctttaagccaagatggaaagaactgtgaagatgtcaacgagtgt
gccttttggaatcatggctgtactcttgggtgtgaaaacatccctggatcctattattgc
acatgccctgtaggatttgttctgcttcctgatgggaaacggtgtcaccaattaatttcc
tgcccaagcaatgtgtctgaatgcagtcatgattgtgttctgacatcagacggtcccata
tgtttctgtcctgaaggctcagtgcttgagacagatgggaaaacctgtagtggttgttca
tctcccgataatggtggatgtagccagctctgcatccctcttagtccagtatcctgggag
tgtggctgcattccagggtatgacctacaactggacaaaaagagctgtacagcctcagga
ccaccaccgtttttgctgtttgccaattctcaagatattcgacacatgcattttgatgga
acagattatggaaccctgctcagccagcaaataggaatggtttttgccctagatcatgac
cctgtggaaaataagatatactttgcccatacagccctaaagtggatagagagagcaaat
atggatggttcccagcgagaaaggcttactgaggaagaagtaggtgtgccagaaggtctt
gctgtagactggattggccgtaaattctattggacagacagagggaaatctctcattgaa
aggagtgatttaaatgggaagtatcgtgaaataatcattaaggaggacatctctcagcca
cgaggacttgctgttcatccaagggccaagagattattctggactgagatggggattaat
ccacgaattgaaagttcttcccttcaaggcattgaccgactggttatagctagctcggat
ctggtctggcccagtggaataacaattgattacttaactgacaagttgtattggtgcgat
gccaagcagtctgtgattgaaatgtccaatctggatggttcaaaacgccaaagacttgcc
cagaacgatgtaggtcacccatttgctgtggctgtgtttgaggatcatgtgtggttctct
gattggactatgccatcggtaataagggtgaacaagaggactggcaaaaatagggtacgt
ctccgaggcagcatgctgaagccctcatcactggttgtagttcatccattggcaaaacca
ggagcagatgcctgcttacatcaaaacggaggctgtgaacatatttgcgaagagaggttt
ggaactgctcagtgtttgtgtcgtgaaggttttgtgaaagctccagatggaaaaacgtgt
ctggctctgaatggccatcagatattggcaggtagtgaagcagatctgagtaatggagta
ataccgttggacatcttacccagcagtagagagcttgaagatactattacagaatctcaa
catatgctagtggctgaaatcatggtgtcagatgacgccgactgtagtgccttgggatgc
agtacacaggcttggtgtgtttcagagggcgagagtgtcacgtgtcggtgtttgaaagga
tttgccggagatggaaaactgtgttctgatatagatgaatgtcagatgggcatctcagtt
tgccctcccacctcctccaagtgcgtcaatactgaaggtggccatgtctgccggtgctca
gaaggctaccagggagatgggatccactgcctcgatattgatgagtgccaactgggcgtg
cacgcctgtggggaaaatgccgcctgtacaaatacggagggaaactacacttgcacgtgt
gctggcaacttgtctgaacctggacggatttgccctgactcgactccaccctctcatccc
agggaggatggccgctctccagtgagaaatatttaccctgaatgtcccccgtcccatgat
gggtactgcctccatggcggtgtgtgtatgtatgttgaagcagtcgacagctatgcctgc
aactgtgtcgttggctacgtcggggagcgatgtcagcaccgagacttgaagtggtgggaa
ctgcgccatgcgggccccgggcggcagcggagcatctccgcggtggtggcctgcgtggtg
gtgctgatcctgctactgtgcctggggctgtgcggggcccagaaatacaggactcagaag
ctgctatcgaaaaatccaaagaatccttatgaagattcaagcagagatgtgagcagtgtc
aggcctgcagatgacgaggctgggttgtcctcttgccgccaaccttggtttgtggttata
aaggaacatcaaaacttctgcaatgggagtcaacctgtagccctcaaggacggcctggtg
gcagatgttggccaattttcttccctggaacctgggtcattgcaaccaacatcatggaga
aaggagccccagatgtatatgggcacagaacaaggatgctgtgtttcatcatccagtgat
aaaggctctagtcaccagagaatgaagtgtagctttcatctcccctcctatggggcatgg
cccattgctgggggagttgagaagtcccattctctcccatcagcttgcccattatggcaa
cagagagctccggatccaccacaccaaatggagctgactcagtga

DBGET integrated database retrieval system