KEGG   Physeter catodon (sperm whale): 102977655
Entry
102977655         CDS       T06011                                 

Gene name
STAT1
Definition
(RefSeq) signal transducer and activator of transcription 1-alpha/beta isoform X1
  KO
K11220  signal transducer and activator of transcription 1
Organism
pcad  Physeter catodon (sperm whale)
Pathway
pcad04062  Chemokine signaling pathway
pcad04217  Necroptosis
pcad04380  Osteoclast differentiation
pcad04620  Toll-like receptor signaling pathway
pcad04621  NOD-like receptor signaling pathway
pcad04625  C-type lectin receptor signaling pathway
pcad04630  JAK-STAT signaling pathway
pcad04658  Th1 and Th2 cell differentiation
pcad04659  Th17 cell differentiation
pcad04917  Prolactin signaling pathway
pcad04919  Thyroid hormone signaling pathway
pcad04933  AGE-RAGE signaling pathway in diabetic complications
pcad04935  Growth hormone synthesis, secretion and action
pcad05140  Leishmaniasis
pcad05145  Toxoplasmosis
pcad05152  Tuberculosis
pcad05160  Hepatitis C
pcad05161  Hepatitis B
pcad05162  Measles
pcad05164  Influenza A
pcad05165  Human papillomavirus infection
pcad05167  Kaposi sarcoma-associated herpesvirus infection
pcad05168  Herpes simplex virus 1 infection
pcad05169  Epstein-Barr virus infection
pcad05171  Coronavirus disease - COVID-19
pcad05200  Pathways in cancer
pcad05212  Pancreatic cancer
pcad05235  PD-L1 expression and PD-1 checkpoint pathway in cancer
pcad05321  Inflammatory bowel disease
Brite
KEGG Orthology (KO) [BR:pcad00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04630 JAK-STAT signaling pathway
    102977655 (STAT1)
 09140 Cellular Processes
  09143 Cell growth and death
   04217 Necroptosis
    102977655 (STAT1)
 09150 Organismal Systems
  09151 Immune system
   04620 Toll-like receptor signaling pathway
    102977655 (STAT1)
   04621 NOD-like receptor signaling pathway
    102977655 (STAT1)
   04625 C-type lectin receptor signaling pathway
    102977655 (STAT1)
   04658 Th1 and Th2 cell differentiation
    102977655 (STAT1)
   04659 Th17 cell differentiation
    102977655 (STAT1)
   04062 Chemokine signaling pathway
    102977655 (STAT1)
  09152 Endocrine system
   04917 Prolactin signaling pathway
    102977655 (STAT1)
   04935 Growth hormone synthesis, secretion and action
    102977655 (STAT1)
   04919 Thyroid hormone signaling pathway
    102977655 (STAT1)
  09158 Development and regeneration
   04380 Osteoclast differentiation
    102977655 (STAT1)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    102977655 (STAT1)
   05235 PD-L1 expression and PD-1 checkpoint pathway in cancer
    102977655 (STAT1)
  09162 Cancer: specific types
   05212 Pancreatic cancer
    102977655 (STAT1)
  09163 Immune disease
   05321 Inflammatory bowel disease
    102977655 (STAT1)
  09167 Endocrine and metabolic disease
   04933 AGE-RAGE signaling pathway in diabetic complications
    102977655 (STAT1)
  09171 Infectious disease: bacterial
   05152 Tuberculosis
    102977655 (STAT1)
  09172 Infectious disease: viral
   05161 Hepatitis B
    102977655 (STAT1)
   05160 Hepatitis C
    102977655 (STAT1)
   05171 Coronavirus disease - COVID-19
    102977655 (STAT1)
   05164 Influenza A
    102977655 (STAT1)
   05162 Measles
    102977655 (STAT1)
   05168 Herpes simplex virus 1 infection
    102977655 (STAT1)
   05167 Kaposi sarcoma-associated herpesvirus infection
    102977655 (STAT1)
   05169 Epstein-Barr virus infection
    102977655 (STAT1)
   05165 Human papillomavirus infection
    102977655 (STAT1)
  09174 Infectious disease: parasitic
   05145 Toxoplasmosis
    102977655 (STAT1)
   05140 Leishmaniasis
    102977655 (STAT1)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03000 Transcription factors [BR:pcad03000]
    102977655 (STAT1)
Transcription factors [BR:pcad03000]
 Eukaryotic type
  beta-Scaffold factors with minor groove contacts
   STAT
    102977655 (STAT1)
SSDB
Motif
Pfam: STAT_alpha STAT_int STAT_bind STAT1_TAZ2bind SH2 TRPM_tetra BLI1
Other DBs
NCBI-GeneID: 102977655
NCBI-ProteinID: XP_007114662
UniProt: A0A2Y9F4W1
LinkDB
Position
2
AA seq 749 aa
MSQWYELQQLDSKFLEQVHQLYDDSFPMEIRQYLAQWLEKQDWDHAANDVSFATIRFHDL
LSQLDDQYSRFSLENNFLLQHNIRKSKRNLQDNFQEDPIQMSMIICNCLKEERKILENAQ
RFNQAQAGNIQSTVMLDKQKELDSRVRNVKDKVMCIEHEIKTLEDLQDEYDFKCKTLQNR
EHETNGVAKNDQKQEQMLLQKMYLMLDNKRKEVVHKIIELLNATELTQKALINDELVEWK
RRQQSACIGGPPNACLDQLQNWFTIVAESLQQVRQQLKKLEELEQKYTYEHDPITKNKQA
LGDRTFSLFQQLIQSSFVVERQPCMPTHPQRPLVLKTGVQFTVKLRLLVKLQELNYNLKV
KVLFDKDVNERNTVKGFRKFNILGTHTKVMNMEESTNGSLAAEFRHLQLKEQKNAGARTN
EGPLIVTEELHSLSFETQLCQPGLVIDLETASLPIVVISNVSQLPSGWASILWYNMLVAE
PRNLSFFLNPPCARWSQLSEVLSWQFSSVTKRGLNVDQLNMLGEKLLGPSAGPDGLIPWT
RFCKENINDKNFPFWLWIESILELIKKHLLCLWNDGCIVGFISKERERALLKDQQPGTFL
LRFSESCREGAITFTWVERPQNGGESCFHAVEPYTKKELSAVTFPDIIRNYKVMAAENIP
ENPLKFLYPNIDKDHAFGKYYSRPKEAPEPMELDGPKGTGYIKTELISVSEVHPSQLQTT
DNLLPMSPEEFDEVSRIVGAVEFDMMNAV
NT seq 2250 nt   +upstreamnt  +downstreamnt
atgtcccagtggtatgagcttcagcagcttgactccaaattcctggagcaggttcaccag
ctctatgatgacagttttcccatggaaatcagacagtatctggcacagtggctagaaaag
caagactgggatcatgctgccaatgatgtttcatttgctaccatccgttttcacgacctc
ctatcgcagctggatgatcaatacagtcgcttctctttggagaataattttttgttgcag
cataacataaggaaaagcaagcgtaatcttcaggataattttcaggaagacccaatacag
atgtctatgataatctgtaactgtctgaaggaggaaagaaagatcttggaaaatgcccag
agattcaatcaggctcaggcagggaatattcagagcaccgtaatgttagacaaacagaag
gaacttgacagcagagtcagaaatgtgaaggacaaagttatgtgtatagagcatgaaatc
aagaccctagaagatttacaggatgaatatgactttaaatgtaaaaccttgcagaacaga
gaacatgaaaccaatggtgtggcaaagaacgatcagaaacaggaacagatgttactccag
aagatgtatttaatgcttgacaataagagaaaggaagtagttcacaaaataatagagttg
ctgaatgctaccgaacttacccagaaagccctgattaacgatgaacttgtggaatggaag
cggagacagcagagtgcctgtatcgggggaccccccaatgcttgccttgatcagctgcag
aactggttcaccatagtggcggagagtctgcagcaggttcgtcagcagcttaaaaagctt
gaggagttggaacagaaatacacctatgaacatgaccctatcacaaaaaacaaacaagcg
ttgggggaccgcaccttcagcctcttccagcagctcattcagagctcatttgtggtggaa
agacagccctgcatgccaactcatcctcagaggccattggtcctgaagactggagtacaa
ttcactgtgaagttgagattgttggtgaaattgcaagagctgaattataacttgaaagtc
aaagtcttatttgataaagatgtgaatgagagaaatacagtaaaagggtttagaaagttc
aacattttgggcacgcacacgaaggtgatgaacatggaggagtccaccaatggaagtctg
gcggcagaattccgacacctgcaactgaaagaacagaaaaatgccggtgccagaaccaac
gagggtcctctcatcgttactgaggagcttcactcccttagttttgaaacccagttgtgc
cagcctggtttggtcattgaccttgagacggcctctctgcccatcgtggtgatctccaat
gtcagccagctcccgagtggttgggcctccatcctgtggtacaacatgctggtggcagaa
cccaggaatctgtccttcttcctgaacccaccttgtgcacgatggtctcagctttcagag
gtgctgagttggcagttttcttctgtcaccaaaagaggtctcaatgtggaccagctgaac
atgctgggagagaaacttcttggtcccagtgctggccctgatggtcttattccatggact
cgcttctgtaaggaaaatataaatgataaaaattttcctttctggctttggatcgaaagc
atccttgaactcattaaaaaacacctactctgtctctggaatgatgggtgtatcgtgggc
tttatcagcaaggagcgagagcgggctctgctgaaggaccagcagccggggacattcctg
ctgcggttcagtgagagctgccgggaaggggccatcacgttcacatgggtggagcggccc
cagaatggaggtgaatcttgcttccatgcggttgaaccctacacaaagaaagaactttct
gctgttactttccccgacattattcgcaattacaaagtcatggccgctgaaaatattcca
gagaatcccttgaagtttctgtatccaaatattgataaagaccatgcctttggaaagtac
tactccaggccaaaggaagccccagagcctatggaacttgatggccctaaaggaacagga
tatatcaagactgaattgatttctgtgtctgaagttcacccttctcaacttcagaccaca
gacaaccttcttcccatgtctcctgaggagtttgacgaggtgtctcggatagtgggcgct
gtagaatttgacatgatgaatgcggtataa

DBGET integrated database retrieval system