KEGG   Physeter catodon (sperm whale): 102978015
Entry
102978015         CDS       T06011                                 

Gene name
SMAD2
Definition
(RefSeq) mothers against decapentaplegic homolog 2
  KO
K04500  mothers against decapentaplegic homolog 2
Organism
pcad  Physeter catodon (sperm whale)
Pathway
pcad04110  Cell cycle
pcad04144  Endocytosis
pcad04218  Cellular senescence
pcad04350  TGF-beta signaling pathway
pcad04371  Apelin signaling pathway
pcad04390  Hippo signaling pathway
pcad04550  Signaling pathways regulating pluripotency of stem cells
pcad04659  Th17 cell differentiation
pcad04926  Relaxin signaling pathway
pcad04933  AGE-RAGE signaling pathway in diabetic complications
pcad05142  Chagas disease
pcad05166  Human T-cell leukemia virus 1 infection
pcad05200  Pathways in cancer
pcad05205  Proteoglycans in cancer
pcad05210  Colorectal cancer
pcad05212  Pancreatic cancer
pcad05225  Hepatocellular carcinoma
pcad05226  Gastric cancer
pcad05321  Inflammatory bowel disease
Brite
KEGG Orthology (KO) [BR:pcad00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04350 TGF-beta signaling pathway
    102978015 (SMAD2)
   04390 Hippo signaling pathway
    102978015 (SMAD2)
   04371 Apelin signaling pathway
    102978015 (SMAD2)
 09140 Cellular Processes
  09141 Transport and catabolism
   04144 Endocytosis
    102978015 (SMAD2)
  09143 Cell growth and death
   04110 Cell cycle
    102978015 (SMAD2)
   04218 Cellular senescence
    102978015 (SMAD2)
  09144 Cellular community - eukaryotes
   04550 Signaling pathways regulating pluripotency of stem cells
    102978015 (SMAD2)
 09150 Organismal Systems
  09151 Immune system
   04659 Th17 cell differentiation
    102978015 (SMAD2)
  09152 Endocrine system
   04926 Relaxin signaling pathway
    102978015 (SMAD2)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    102978015 (SMAD2)
   05205 Proteoglycans in cancer
    102978015 (SMAD2)
  09162 Cancer: specific types
   05210 Colorectal cancer
    102978015 (SMAD2)
   05212 Pancreatic cancer
    102978015 (SMAD2)
   05225 Hepatocellular carcinoma
    102978015 (SMAD2)
   05226 Gastric cancer
    102978015 (SMAD2)
  09163 Immune disease
   05321 Inflammatory bowel disease
    102978015 (SMAD2)
  09167 Endocrine and metabolic disease
   04933 AGE-RAGE signaling pathway in diabetic complications
    102978015 (SMAD2)
  09172 Infectious disease: viral
   05166 Human T-cell leukemia virus 1 infection
    102978015 (SMAD2)
  09174 Infectious disease: parasitic
   05142 Chagas disease
    102978015 (SMAD2)
SSDB
Motif
Pfam: MH2 MH1 IRF-3
Other DBs
NCBI-GeneID: 102978015
NCBI-ProteinID: XP_023987958
UniProt: A0A2Y9TEE0
LinkDB
Position
19
AA seq 467 aa
MSSILPFTPPVVKRLLGWKKSAGGSGGAGGGEQNGQEEKWCEKAVKSLVKKLKKTGRLDE
LEKAITTQNCNTKCVTIPSTCSEIWGLSTPNTIDQWDTTGLYSFSEQTRSLDGRLQVSHR
KGLPHVIYCRLWRWPDLHSHHELKAIENCEYAFNLKKDEVCVNPYHYQRVETPVLPPVLV
PRHTEILTELPPLDDYTHSIPENTNFPAGIEPQSNYIPETPPPGYISEDGETSDQQLNQS
MDTGSPAELSPTTLSPVNHSLDLQPVTYSEPAFWCSIAYYELNQRVGETFHASQPSLTVD
GFTDPSNSERFCLGLLSNVNRNATVEMTRRHIGRGVRLYYIGGEVFAECLSDSAIFVQSP
NCNQRYGWHPATVCKIPPGCNLKIFNNQEFAALLAQSVNQGFEAVYQLTRMCTIRMSFVK
GWGAEYRRQTVTSTPCWIELHLNGPLQWLDKVLTQMGSPSVRCSSMS
NT seq 1404 nt   +upstreamnt  +downstreamnt
atgtcgtccatcttgccattcactccaccagttgtgaagagactgctgggatggaaaaaa
tcagctggtggatctggaggagcaggtggtggagagcagaatggacaggaagaaaagtgg
tgtgagaaagcagttaaaagtttggtgaagaagctaaagaaaacaggacgattagatgag
cttgagaaagccatcaccactcaaaattgtaatactaaatgtgttaccataccaagcact
tgctctgaaatttggggactgagtacaccaaatacgatagatcagtgggatacaacaggc
ctttacagcttctctgaacaaaccaggtctcttgatggtcgtcttcaggtatctcatcgg
aaaggactgccgcatgtaatatattgccgattatggcgctggcctgatcttcacagtcat
catgaactcaaggcaattgaaaactgcgaatatgcttttaatcttaaaaaggatgaagta
tgtgtaaacccttaccactaccagagagttgagacaccagttttgcctccggtgttagtg
ccacggcatactgagatcttaacagaactaccacctctggatgattatacccactccatt
ccagaaaacactaatttcccagcgggaattgagccacagagtaattatatcccagaaacg
ccacctcctggatatatcagtgaagatggagaaacaagtgatcaacagttgaaccaaagt
atggatacaggatctccagcagaactatctcctactactctttcccctgttaatcatagt
ttggatttgcagcctgttacttactcagaacctgcattttggtgttcaatagcgtattat
gaattaaaccagagggttggagagaccttccatgcatcacagccctcactcaccgtagac
ggcttcacagatccatcaaattcagagaggttctgcctcggtttactctctaacgtcaac
agaaatgctacagtagaaatgacaagaagacatataggaagaggagtgcgcttatattac
ataggtggggaagtttttgctgagtgcctaagtgatagtgcaatctttgtgcagagcccc
aattgtaatcagagatacggctggcaccctgcaacagtgtgtaaaattccaccaggctgt
aacctgaagatcttcaacaaccaggaatttgctgctcttctggctcagtccgttaatcag
ggttttgaagccgtgtatcagctaactagaatgtgcaccataagaatgagttttgtgaaa
gggtggggtgcagaataccgaaggcagacagtaacaagcactccttgctggattgaactt
catctgaatggacctctacagtggttggacaaagtattaactcagatgggatccccttca
gtgcgttgctcaagcatgtcataa

KEGG   Physeter catodon (sperm whale): 102989819
Entry
102989819         CDS       T06011                                 

Gene name
SMAD3
Definition
(RefSeq) mothers against decapentaplegic homolog 3 isoform X2
  KO
K23605  mothers against decapentaplegic homolog 3
Organism
pcad  Physeter catodon (sperm whale)
Pathway
pcad04068  FoxO signaling pathway
pcad04110  Cell cycle
pcad04144  Endocytosis
pcad04218  Cellular senescence
pcad04310  Wnt signaling pathway
pcad04350  TGF-beta signaling pathway
pcad04371  Apelin signaling pathway
pcad04390  Hippo signaling pathway
pcad04520  Adherens junction
pcad04550  Signaling pathways regulating pluripotency of stem cells
pcad04659  Th17 cell differentiation
pcad04933  AGE-RAGE signaling pathway in diabetic complications
pcad05161  Hepatitis B
pcad05166  Human T-cell leukemia virus 1 infection
pcad05200  Pathways in cancer
pcad05210  Colorectal cancer
pcad05212  Pancreatic cancer
pcad05220  Chronic myeloid leukemia
pcad05225  Hepatocellular carcinoma
pcad05226  Gastric cancer
pcad05321  Inflammatory bowel disease
Brite
KEGG Orthology (KO) [BR:pcad00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04310 Wnt signaling pathway
    102989819 (SMAD3)
   04350 TGF-beta signaling pathway
    102989819 (SMAD3)
   04390 Hippo signaling pathway
    102989819 (SMAD3)
   04371 Apelin signaling pathway
    102989819 (SMAD3)
   04068 FoxO signaling pathway
    102989819 (SMAD3)
 09140 Cellular Processes
  09141 Transport and catabolism
   04144 Endocytosis
    102989819 (SMAD3)
  09143 Cell growth and death
   04110 Cell cycle
    102989819 (SMAD3)
   04218 Cellular senescence
    102989819 (SMAD3)
  09144 Cellular community - eukaryotes
   04520 Adherens junction
    102989819 (SMAD3)
   04550 Signaling pathways regulating pluripotency of stem cells
    102989819 (SMAD3)
 09150 Organismal Systems
  09151 Immune system
   04659 Th17 cell differentiation
    102989819 (SMAD3)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    102989819 (SMAD3)
  09162 Cancer: specific types
   05210 Colorectal cancer
    102989819 (SMAD3)
   05212 Pancreatic cancer
    102989819 (SMAD3)
   05225 Hepatocellular carcinoma
    102989819 (SMAD3)
   05226 Gastric cancer
    102989819 (SMAD3)
   05220 Chronic myeloid leukemia
    102989819 (SMAD3)
  09163 Immune disease
   05321 Inflammatory bowel disease
    102989819 (SMAD3)
  09167 Endocrine and metabolic disease
   04933 AGE-RAGE signaling pathway in diabetic complications
    102989819 (SMAD3)
  09172 Infectious disease: viral
   05166 Human T-cell leukemia virus 1 infection
    102989819 (SMAD3)
   05161 Hepatitis B
    102989819 (SMAD3)
SSDB
Motif
Pfam: MH2 MH1 IRF-3
Other DBs
NCBI-GeneID: 102989819
NCBI-ProteinID: XP_007127897
UniProt: A0A2Y9FQZ8
LinkDB
Position
11
AA seq 425 aa
MSSILPFTPPIVKRLLGWKKGEQNGQEEKWCEKAVKSLVKKLKKTGQLDELEKAITTQNV
NTKCITIPRSLDGRLQVSHRKGLPHVIYCRLWRWPDLHSHHELRAMELCEFAFNMKKDEV
CVNPYHYQRVETPVLPPVLVPRHTEIPAEFPPLDDYSHSIPENTNFPAGIEPQSNIPETP
PPGYLSEDGETSDHQMNHSMDAGSPNLSPNPMSPAHNNLDLQPVTYCEPAFWCSISYYEL
NQRVGETFHASQPSMTVDGFTDPSNSERFCLGLLSNVNRNAAVELTRRHIGRGVRLYYIG
GEVFAECLSDSAIFVQSPNCNQRYGWHPATVCKIPPGCNLKIFNNQEFAALLAQSVNQGF
EAVYQLTRMCTIRMSFVKGWGAEYRRQTVTSTPCWIELHLNGPLQWLDKVLTQMGSPSIR
CSSVS
NT seq 1278 nt   +upstreamnt  +downstreamnt
atgtcgtccatcctgcccttcacccccccgatcgtgaagcgcctgctgggctggaagaag
ggcgagcagaacggtcaggaggagaagtggtgcgagaaggcggtcaagagtttggtcaag
aagctcaagaagacggggcagctggacgagctggagaaggccatcaccacgcagaacgtc
aacaccaagtgcatcaccatccccaggtccctggatggccggctgcaggtgtcccaccgg
aaggggctcccccatgttatctactgccgcctgtggcgatggcccgacctacacagccac
catgagctgcgggccatggagctgtgtgagttcgccttcaacatgaagaaggacgaagtc
tgcgtgaatccctaccactatcagagggtggagaccccagttctacctcctgtgttggta
ccacgccacacagagatcccggccgagttccccccgctggacgactacagccattccatc
cccgaaaacactaactttcccgccggcatcgagccccagagcaatattccagaaacccca
cccccgggctacttgagtgaagatggagagaccagtgaccaccagatgaaccacagcatg
gacgcaggttctccaaacctatccccgaatccgatgtccccagcacacaataacttggac
ctgcagcccgtcacctactgcgagccggccttctggtgctccatctcctactacgagctc
aaccagcgtgtcggggagacattccatgcctcgcagccgtccatgacagtggatggcttc
accgatccctccaactcagagcgcttctgcctggggttgctctccaacgtcaacaggaac
gcggccgtggagctgacgcggaggcatatcgggcgaggcgtgcggctgtactacatcgga
ggcgaggtcttcgcagagtgcctcagcgacagtgccatctttgtccagtctcccaactgt
aaccagcgctacggctggcacccagccaccgtctgcaagatcccaccaggatgcaacctg
aagatcttcaacaaccaggagtttgccgccctcctggctcagtctgtcaaccagggcttc
gaggccgtgtaccagctgacccggatgtgcaccatccgcatgagcttcgtcaagggctgg
ggagccgagtacaggagacagaccgtgaccagcaccccctgctggatcgagctgcacctg
aatgggcctttgcagtggcttgacaaggtcctcacccagatgggctccccaagcatccgc
tgctccagtgtatcttag

DBGET integrated database retrieval system