KEGG   Physeter catodon (sperm whale): 102978050
Entry
102978050         CDS       T06011                                 

Gene name
TGFBR1
Definition
(RefSeq) TGF-beta receptor type-1 isoform X1
  KO
K04674  TGF-beta receptor type-1 [EC:2.7.11.30]
Organism
pcad  Physeter catodon (sperm whale)
Pathway
pcad04010  MAPK signaling pathway
pcad04060  Cytokine-cytokine receptor interaction
pcad04068  FoxO signaling pathway
pcad04144  Endocytosis
pcad04218  Cellular senescence
pcad04350  TGF-beta signaling pathway
pcad04371  Apelin signaling pathway
pcad04380  Osteoclast differentiation
pcad04390  Hippo signaling pathway
pcad04520  Adherens junction
pcad04659  Th17 cell differentiation
pcad04926  Relaxin signaling pathway
pcad04933  AGE-RAGE signaling pathway in diabetic complications
pcad05142  Chagas disease
pcad05161  Hepatitis B
pcad05166  Human T-cell leukemia virus 1 infection
pcad05200  Pathways in cancer
pcad05210  Colorectal cancer
pcad05212  Pancreatic cancer
pcad05220  Chronic myeloid leukemia
pcad05225  Hepatocellular carcinoma
pcad05226  Gastric cancer
Brite
KEGG Orthology (KO) [BR:pcad00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04010 MAPK signaling pathway
    102978050 (TGFBR1)
   04350 TGF-beta signaling pathway
    102978050 (TGFBR1)
   04390 Hippo signaling pathway
    102978050 (TGFBR1)
   04371 Apelin signaling pathway
    102978050 (TGFBR1)
   04068 FoxO signaling pathway
    102978050 (TGFBR1)
  09133 Signaling molecules and interaction
   04060 Cytokine-cytokine receptor interaction
    102978050 (TGFBR1)
 09140 Cellular Processes
  09141 Transport and catabolism
   04144 Endocytosis
    102978050 (TGFBR1)
  09143 Cell growth and death
   04218 Cellular senescence
    102978050 (TGFBR1)
  09144 Cellular community - eukaryotes
   04520 Adherens junction
    102978050 (TGFBR1)
 09150 Organismal Systems
  09151 Immune system
   04659 Th17 cell differentiation
    102978050 (TGFBR1)
  09152 Endocrine system
   04926 Relaxin signaling pathway
    102978050 (TGFBR1)
  09158 Development and regeneration
   04380 Osteoclast differentiation
    102978050 (TGFBR1)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    102978050 (TGFBR1)
  09162 Cancer: specific types
   05210 Colorectal cancer
    102978050 (TGFBR1)
   05212 Pancreatic cancer
    102978050 (TGFBR1)
   05225 Hepatocellular carcinoma
    102978050 (TGFBR1)
   05226 Gastric cancer
    102978050 (TGFBR1)
   05220 Chronic myeloid leukemia
    102978050 (TGFBR1)
  09167 Endocrine and metabolic disease
   04933 AGE-RAGE signaling pathway in diabetic complications
    102978050 (TGFBR1)
  09172 Infectious disease: viral
   05166 Human T-cell leukemia virus 1 infection
    102978050 (TGFBR1)
   05161 Hepatitis B
    102978050 (TGFBR1)
  09174 Infectious disease: parasitic
   05142 Chagas disease
    102978050 (TGFBR1)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01001 Protein kinases [BR:pcad01001]
    102978050 (TGFBR1)
Enzymes [BR:pcad01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.11  Protein-serine/threonine kinases
    2.7.11.30  receptor protein serine/threonine kinase
     102978050 (TGFBR1)
Protein kinases [BR:pcad01001]
 Receptor serine/threonine kinases (RSTK): TKL group
  TGFBR1 family [OT]
   102978050 (TGFBR1)
SSDB
Motif
Pfam: Pkinase PK_Tyr_Ser-Thr TGF_beta_GS Activin_recp Pkinase_fungal APH FTA2
Other DBs
NCBI-GeneID: 102978050
NCBI-ProteinID: XP_023982305
UniProt: A0A2Y9T0D7
LinkDB
Position
9
AA seq 575 aa
MEAAAAAPRPRLLLLVLATAATLVPEVTALQCFCHLCTKDNFTCVTDGLCFVSVTETTDK
VIHNSMCIAEIDLIPRDRPFVCAPSSKTGSVTTTYCCNQDHCNKIELPTVGPFPGKPSSG
LGPVELAAVIAGPVCFVCISLMLMVYICHNRTVIHHRVPNEEDPSLDRPFISEGTTLKDL
IYDMTTSGSGSGLPLLVQRTIARTIVLQESIGKGRFGEVWRGKWRGEEVAVKIFSSREER
SWFREAEIYQTVMLRHENILGFIAADNKDNGTWTQLWLVSDYHEHGSLFDYLNRYTVTVE
GMIKLALSTASGLAHLHMEIVGTQGKPAIAHRDLKSKNILVKKNGTCCIADLGLAVRHDS
ATDTIDIAPNHRVGTKRYMAPEVLDDSINMKHFESFKRADIYAMGLVFWEIARRCSIGGI
HEDYQLPYYDLVPSDPSVEEMRKVVCEQKLRPNIPNRWQSCEGFTNLLSRAETHQEFETD
RIPPEASSEPSFSSLNWLFSWPAFILGYPSPFICDSLCLFYSESSFLDPTSSCFLVCSFS
PPFSSLLRCYLVSETLPLNLFKIAPSFPGIFYLLL
NT seq 1728 nt   +upstreamnt  +downstreamnt
atggaggcggcggccgctgctccacgtccccggctgctcctcctcgtgctggcgacggcg
gcaacgctggtcccggaggtgacggcattacagtgtttctgccatctttgtacaaaagac
aattttacttgtgtcacagatgggctctgctttgtctctgtcacagagactacagacaaa
gttatacataatagcatgtgtatagctgaaatcgacctaattccacgagacaggccattt
gtatgtgcaccatcttcaaaaactgggtctgttactacaacatattgctgcaatcaggac
cattgcaataaaatagaactcccaactgttggcccttttccaggaaagccatcatctggc
cttggtcctgtcgaactggcagctgtcattgctggaccagtatgcttcgtttgcatctca
ctcatgttgatggtctatatctgtcataaccgcactgtcattcaccatcgagtgccaaat
gaagaggatccttcattagatcgcccctttatttcagagggtactacgttaaaagattta
atttatgatatgacaacatcgggttctggatcaggtttaccattgcttgttcagaggaca
attgcgagaactattgtgttacaagaaagtattggcaaaggtcgttttggagaagtttgg
cgaggaaaatggagaggagaagaagttgctgttaaaatattctcctctagagaagaacgt
tcatggttccgtgaggcagagatttatcagaccgtcatgttacgtcatgaaaacatcttg
ggatttatagcggcagacaataaagacaatggtacatggactcagctctggttggtgtca
gattatcatgagcatggatccctttttgattacttgaacagatacacagttactgtggaa
ggaatgataaaactcgctctgtccacagcaagtggacttgcccatcttcacatggagata
gttggtacccaaggaaaaccagccattgctcatagggatttgaaatcaaaaaatatcttg
gtaaagaagaatggaacttgctgtattgcagacttgggactggcagtaagacatgattcg
gccacagatacaattgatattgctccaaaccacagagtgggaacaaaaaggtacatggcc
cctgaagttctagatgattccataaatatgaaacacttcgaatccttcaaacgtgctgac
atctatgcaatgggactagtattctgggaaatagctcgacgatgttccattggtggaatt
catgaagattaccagctgccttattatgatcttgtaccttctgatccatcagttgaagaa
atgagaaaagttgtttgtgaacagaagttaaggccaaatattccaaacagatggcagagc
tgtgaaggttttacaaatctcctctcaagagctgaaacacatcaagaatttgaaactgat
aggatacctccagaagcgtcttcagaaccctctttttccagtctgaactggttgttctct
tggccagctttcatcttgggatatccctcacctttcatctgtgattccctttgcctcttt
tatagtgaatcctccttcctggatcccacatcttcctgtttcttggtttgctcattttcc
ccccctttcagctctctgctcagatgttaccttgtcagtgagacattacctctcaaccta
tttaaaatagcaccttccttccctggcatattttatctccttctctaa

DBGET integrated database retrieval system