KEGG   Physeter catodon (sperm whale): 102978131
Entry
102978131         CDS       T06011                                 

Gene name
ATF6B
Definition
(RefSeq) LOW QUALITY PROTEIN: cyclic AMP-dependent transcription factor ATF-6 beta
  KO
K09049  cyclic AMP-dependent transcription factor ATF-6 beta
Organism
pcad  Physeter catodon (sperm whale)
Pathway
pcad04022  cGMP-PKG signaling pathway
pcad04141  Protein processing in endoplasmic reticulum
pcad04151  PI3K-Akt signaling pathway
pcad04211  Longevity regulating pathway
pcad04261  Adrenergic signaling in cardiomyocytes
pcad04668  TNF signaling pathway
pcad04728  Dopaminergic synapse
pcad04911  Insulin secretion
pcad04915  Estrogen signaling pathway
pcad04918  Thyroid hormone synthesis
pcad04925  Aldosterone synthesis and secretion
pcad04926  Relaxin signaling pathway
pcad04927  Cortisol synthesis and secretion
pcad04928  Parathyroid hormone synthesis, secretion and action
pcad04934  Cushing syndrome
pcad04935  Growth hormone synthesis, secretion and action
pcad05020  Prion disease
pcad05030  Cocaine addiction
pcad05031  Amphetamine addiction
pcad05034  Alcoholism
pcad05161  Hepatitis B
pcad05163  Human cytomegalovirus infection
pcad05166  Human T-cell leukemia virus 1 infection
pcad05203  Viral carcinogenesis
Brite
KEGG Orthology (KO) [BR:pcad00001]
 09120 Genetic Information Processing
  09123 Folding, sorting and degradation
   04141 Protein processing in endoplasmic reticulum
    102978131 (ATF6B)
 09130 Environmental Information Processing
  09132 Signal transduction
   04668 TNF signaling pathway
    102978131 (ATF6B)
   04022 cGMP-PKG signaling pathway
    102978131 (ATF6B)
   04151 PI3K-Akt signaling pathway
    102978131 (ATF6B)
 09150 Organismal Systems
  09152 Endocrine system
   04911 Insulin secretion
    102978131 (ATF6B)
   04915 Estrogen signaling pathway
    102978131 (ATF6B)
   04926 Relaxin signaling pathway
    102978131 (ATF6B)
   04935 Growth hormone synthesis, secretion and action
    102978131 (ATF6B)
   04918 Thyroid hormone synthesis
    102978131 (ATF6B)
   04928 Parathyroid hormone synthesis, secretion and action
    102978131 (ATF6B)
   04925 Aldosterone synthesis and secretion
    102978131 (ATF6B)
   04927 Cortisol synthesis and secretion
    102978131 (ATF6B)
  09153 Circulatory system
   04261 Adrenergic signaling in cardiomyocytes
    102978131 (ATF6B)
  09156 Nervous system
   04728 Dopaminergic synapse
    102978131 (ATF6B)
  09149 Aging
   04211 Longevity regulating pathway
    102978131 (ATF6B)
 09160 Human Diseases
  09161 Cancer: overview
   05203 Viral carcinogenesis
    102978131 (ATF6B)
  09164 Neurodegenerative disease
   05020 Prion disease
    102978131 (ATF6B)
  09165 Substance dependence
   05030 Cocaine addiction
    102978131 (ATF6B)
   05031 Amphetamine addiction
    102978131 (ATF6B)
   05034 Alcoholism
    102978131 (ATF6B)
  09167 Endocrine and metabolic disease
   04934 Cushing syndrome
    102978131 (ATF6B)
  09172 Infectious disease: viral
   05166 Human T-cell leukemia virus 1 infection
    102978131 (ATF6B)
   05161 Hepatitis B
    102978131 (ATF6B)
   05163 Human cytomegalovirus infection
    102978131 (ATF6B)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03000 Transcription factors [BR:pcad03000]
    102978131 (ATF6B)
Transcription factors [BR:pcad03000]
 Eukaryotic type
  Basic leucine zipper (bZIP)
   CREB
    102978131 (ATF6B)
SSDB
Motif
Pfam: bZIP_1 bZIP_2 bZIP_Maf DUF4407 GIT_CC ZapB YabA Docking
Other DBs
NCBI-GeneID: 102978131
NCBI-ProteinID: XP_007118674
UniProt: A0A2Y9FAS1
LinkDB
Position
18
AA seq 708 aa
MAELMLLSEIADPTRFFTDNLLSPEDWDSTLYAGLDEVAEEQTQLFLCPEQDVPFGSSSL
DLGMDVSPPEPPWDSLPIFPDLQVKSEPSSPCSSSSVSSESSRLSTEPSSQASGVGEVLV
VKSESLTPSLCLLGDDPTSPFETIQINVGPTSDDPSDVQIKIEPVSPSSSINSEASLLSA
ESPNQAFIGEEVLEVKTESPSPQGCLLRDVSGPPLGAVQISMGLSSDGSSGKPLPARKPP
LQPKPVVITTVPMPPRAVPPSTTVLLQPLVQPPPVSPVVLIQGAIRVQPEGLTPPAPRPE
RKSIVPAPMPGNSCPPEVDAKLLKRQQRMIKNRESACQSRRKKKEYLQGLEARLQAVLAD
NQQLRRENAALRRRLEALLAENSELKLGSGNRKVVCIMVFLLFIAFNFGPVSISEPPPAP
FSPRMSREEPRPQRHLLEFSAQEPVHGVEHPQHPSQGPRETQPSSTGQPSFRNLTAFPGG
TKELLLRDLDQLFLSSDCRHFNRTESLRLADELSGWVQRHQRGRRKMPQRPQERQKPQLW
KKSPPVKAVPTQPPGPPERDSVGQLQLYRQPDRSQPEFLDAIDRREDTFYVVSFRRDHLL
LPAISHNKTSRPKMSLVMPAMAPNETLSGRGPPGDYEEMMQIECEVMDTRVIHIKTSTVP
PSLRKQPSSAPGNATGGPLPASAASQAHRAARQPXYLNHPRPLRLTLT
NT seq 2127 nt   +upstreamnt  +downstreamnt
atggcggagctgatgctcctcagcgagattgcggacccgacgcgctttttcaccgacaat
ttgctgagcccggaggactgggacagcaccttatacgccggcctggatgaagtggccgag
gagcagacgcagctcttcctttgcccggagcaggatgtcccgtttggcagcagttccctg
gacttggggatggatgtcagccctcctgaacccccctgggactctctgcctatcttccca
gatcttcaggtgaagtctgagccatcctccccctgctcttcctcctccgtcagctctgaa
tcgtcgcgtctttctacagagccctccagccaggcctctggtgtaggggaggtgctggtc
gtgaagtcagagtccttgacaccctcactctgcctcctgggagatgatccaacatcccca
tttgaaaccatccagatcaatgtgggccccacctctgatgatccctcagatgtccagatt
aagatagagcctgtctctccatcttcctccatcaactcggaggcttccctgctctctgcg
gagtcccccaaccaggcttttataggagaggaggtactggaagtgaagacagagtcccca
tcccctcaagggtgtctcttgcgggatgtctcaggccccccacttggagctgtccagatc
agcatgggcctgtcctctgatggctcctcaggcaaacccctgccagcccggaagccacca
ctgcagcccaaacctgtggtgataaccactgtcccgatgccaccgagagctgtgcctccc
agcaccactgtccttttgcagccccttgtccagccacccccagtgtccccagttgttctc
atccaaggtgctattcgagtccagcctgagggactgaccccccctgctccacggcctgag
aggaagagcattgttccagctcctatgcctgggaactcctgcccgcctgaggtggatgca
aagctgctgaagcggcagcagcgaatgatcaagaaccgggagtcggcctgccagtcccgg
aggaagaagaaagagtatctgcaggggctggaagctcggctgcaggcggtgctggccgat
aaccagcagctccggcgggagaatgctgccctccgccggcgcctggaggccctgctggct
gagaacagcgagctcaagttagggtctggaaacaggaaggtggtctgcatcatggttttc
cttctcttcattgccttcaacttcgggcctgtcagcatcagtgagcctcctccagctccc
ttctctcctcggatgagcagagaggagcctcgaccccagagacacttgctggagttctcg
gcgcaagagccagttcacggagtcgagcacccccagcatccctcccagggtcccagggag
acccagcccagctccacgggccagccaagtttcaggaacctgacagccttccctgggggc
accaaggagctgctgctgagagacctggaccagctcttcctctcctctgattgccggcac
ttcaaccgaaccgagtccctgaggcttgctgatgagctcagtggctgggtccagcgccac
cagagaggccggcggaagatgccccagaggccccaggagagacagaagcctcagctatgg
aagaagtcgcctccagttaaggcagtccccacccaaccccctgggcccccagaaagggat
tctgtgggccagctgcagctgtatcgccaaccagaccgttcgcagccagagttcctggat
gcaattgaccgacgggaagacacattttatgttgtctccttccgaagggaccacttgctg
ctcccagccatcagccacaacaagacctctcggcccaagatgtccctggtgatgcccgcc
atggcccccaatgagaccctgtcaggccgggggcccccgggggactatgaggagatgatg
cagatcgagtgtgaggtcatggacaccagggtgattcacatcaagacctccacggtgccc
ccctcgctccgaaaacagccgtcctcagccccgggcaatgccacaggtggccccttgcca
gcttctgcagccagccaggcccaccgggccgcccgtcagcccntctacctcaatcatccc
cgacctctacgactcacactgacttag

DBGET integrated database retrieval system