KEGG   Physeter catodon (sperm whale): 102978702
Entry
102978702         CDS       T06011                                 

Gene name
GSK3B
Definition
(RefSeq) glycogen synthase kinase-3 beta isoform X1
  KO
K03083  glycogen synthase kinase 3 beta [EC:2.7.11.26]
Organism
pcad  Physeter catodon (sperm whale)
Pathway
pcad01521  EGFR tyrosine kinase inhibitor resistance
pcad04012  ErbB signaling pathway
pcad04062  Chemokine signaling pathway
pcad04110  Cell cycle
pcad04150  mTOR signaling pathway
pcad04151  PI3K-Akt signaling pathway
pcad04310  Wnt signaling pathway
pcad04340  Hedgehog signaling pathway
pcad04360  Axon guidance
pcad04390  Hippo signaling pathway
pcad04510  Focal adhesion
pcad04550  Signaling pathways regulating pluripotency of stem cells
pcad04657  IL-17 signaling pathway
pcad04660  T cell receptor signaling pathway
pcad04662  B cell receptor signaling pathway
pcad04722  Neurotrophin signaling pathway
pcad04728  Dopaminergic synapse
pcad04910  Insulin signaling pathway
pcad04916  Melanogenesis
pcad04917  Prolactin signaling pathway
pcad04919  Thyroid hormone signaling pathway
pcad04931  Insulin resistance
pcad04932  Non-alcoholic fatty liver disease
pcad04934  Cushing syndrome
pcad04935  Growth hormone synthesis, secretion and action
pcad05010  Alzheimer disease
pcad05020  Prion disease
pcad05022  Pathways of neurodegeneration - multiple diseases
pcad05135  Yersinia infection
pcad05160  Hepatitis C
pcad05162  Measles
pcad05163  Human cytomegalovirus infection
pcad05165  Human papillomavirus infection
pcad05167  Kaposi sarcoma-associated herpesvirus infection
pcad05200  Pathways in cancer
pcad05210  Colorectal cancer
pcad05213  Endometrial cancer
pcad05215  Prostate cancer
pcad05217  Basal cell carcinoma
pcad05224  Breast cancer
pcad05225  Hepatocellular carcinoma
pcad05226  Gastric cancer
Brite
KEGG Orthology (KO) [BR:pcad00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04012 ErbB signaling pathway
    102978702 (GSK3B)
   04310 Wnt signaling pathway
    102978702 (GSK3B)
   04340 Hedgehog signaling pathway
    102978702 (GSK3B)
   04390 Hippo signaling pathway
    102978702 (GSK3B)
   04151 PI3K-Akt signaling pathway
    102978702 (GSK3B)
   04150 mTOR signaling pathway
    102978702 (GSK3B)
 09140 Cellular Processes
  09143 Cell growth and death
   04110 Cell cycle
    102978702 (GSK3B)
  09144 Cellular community - eukaryotes
   04510 Focal adhesion
    102978702 (GSK3B)
   04550 Signaling pathways regulating pluripotency of stem cells
    102978702 (GSK3B)
 09150 Organismal Systems
  09151 Immune system
   04660 T cell receptor signaling pathway
    102978702 (GSK3B)
   04657 IL-17 signaling pathway
    102978702 (GSK3B)
   04662 B cell receptor signaling pathway
    102978702 (GSK3B)
   04062 Chemokine signaling pathway
    102978702 (GSK3B)
  09152 Endocrine system
   04910 Insulin signaling pathway
    102978702 (GSK3B)
   04917 Prolactin signaling pathway
    102978702 (GSK3B)
   04935 Growth hormone synthesis, secretion and action
    102978702 (GSK3B)
   04919 Thyroid hormone signaling pathway
    102978702 (GSK3B)
   04916 Melanogenesis
    102978702 (GSK3B)
  09156 Nervous system
   04728 Dopaminergic synapse
    102978702 (GSK3B)
   04722 Neurotrophin signaling pathway
    102978702 (GSK3B)
  09158 Development and regeneration
   04360 Axon guidance
    102978702 (GSK3B)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    102978702 (GSK3B)
  09162 Cancer: specific types
   05210 Colorectal cancer
    102978702 (GSK3B)
   05225 Hepatocellular carcinoma
    102978702 (GSK3B)
   05226 Gastric cancer
    102978702 (GSK3B)
   05217 Basal cell carcinoma
    102978702 (GSK3B)
   05215 Prostate cancer
    102978702 (GSK3B)
   05213 Endometrial cancer
    102978702 (GSK3B)
   05224 Breast cancer
    102978702 (GSK3B)
  09164 Neurodegenerative disease
   05010 Alzheimer disease
    102978702 (GSK3B)
   05020 Prion disease
    102978702 (GSK3B)
   05022 Pathways of neurodegeneration - multiple diseases
    102978702 (GSK3B)
  09167 Endocrine and metabolic disease
   04932 Non-alcoholic fatty liver disease
    102978702 (GSK3B)
   04931 Insulin resistance
    102978702 (GSK3B)
   04934 Cushing syndrome
    102978702 (GSK3B)
  09171 Infectious disease: bacterial
   05135 Yersinia infection
    102978702 (GSK3B)
  09172 Infectious disease: viral
   05160 Hepatitis C
    102978702 (GSK3B)
   05162 Measles
    102978702 (GSK3B)
   05163 Human cytomegalovirus infection
    102978702 (GSK3B)
   05167 Kaposi sarcoma-associated herpesvirus infection
    102978702 (GSK3B)
   05165 Human papillomavirus infection
    102978702 (GSK3B)
  09176 Drug resistance: antineoplastic
   01521 EGFR tyrosine kinase inhibitor resistance
    102978702 (GSK3B)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01001 Protein kinases [BR:pcad01001]
    102978702 (GSK3B)
  09182 Protein families: genetic information processing
   03036 Chromosome and associated proteins [BR:pcad03036]
    102978702 (GSK3B)
Enzymes [BR:pcad01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.11  Protein-serine/threonine kinases
    2.7.11.26  tau-protein kinase
     102978702 (GSK3B)
Protein kinases [BR:pcad01001]
 Serine/threonine kinases: CMGC group
  GSK family [OT]
   102978702 (GSK3B)
Chromosome and associated proteins [BR:pcad03036]
 Eukaryotic type
  Centrosome formation and ciliogenesis proteins
   Kinases and associated factors
    102978702 (GSK3B)
SSDB
Motif
Pfam: Pkinase PK_Tyr_Ser-Thr Kinase-like APH Kdo ABC1
Other DBs
NCBI-GeneID: 102978702
NCBI-ProteinID: XP_023976204
UniProt: A0A2Y9SKD3
LinkDB
Position
1
AA seq 433 aa
MSGRPRTTSFAESCKPVQQPSAFGSMKVSRDKDGSKVTTVVATPGQGPDRPQEVSYTDTK
VIGNGSFGVVYQAKLCDSGELVAIKKVLQDKRFKNRELQIMRKLDHCNIVRLRYFFYSSG
EKKDEVYLNLVLDYVPETVYRVARHYSRAKQTLPVIYVKLYMYQLFRSLAYIHSFGICHR
DIKPQNLLLDPDTAVLKLCDFGSAKQLVRGEPNVSYICSRYYRAPELIFGATDYTSSIDV
WSAGCVLAELLLGQPIFPGDSGVDQLVEIIKVLGTPTREQIREMNPNYTEFKFPQIKAHP
WTKDSSGTGHFTSGVRVFRPRTPPEAIALCSRLLEYTPTARLTPLEACAHSFFDELRDPN
VKLPNGRDTPALFNFTTQELSSNPPLATILIPPHARIQAAASTPSNTTAASDANAGDRGQ
TNNAASASASNST
NT seq 1302 nt   +upstreamnt  +downstreamnt
atgtcagggcggcccagaaccacctcctttgcggagagctgcaagccagtgcagcagcct
tcagcttttggcagcatgaaagttagcagagacaaggatggcagcaaggtgaccacagtg
gtggcaactcctgggcagggtccagacaggccacaagaagtcagctatacagacactaaa
gtgattgggaatgggtcatttggtgtggtatatcaagccaaactttgtgattcaggagaa
ctggttgccatcaagaaagtattgcaggacaagagatttaagaaccgagagctccaaatc
atgagaaagctagatcactgtaacatagtccgattgcgttatttcttctactcaagtggt
gaaaagaaagatgaggtctatcttaatctggtgctggactatgttccggaaacagtatac
agagttgccagacactatagtcgagccaaacagacgctccctgtgatctatgttaagttg
tatatgtatcagctgttccgaagtttagcctatatccattcctttggaatctgccatcgg
gatattaaaccacagaacctcttgttggatcctgatacagctgtcttaaaactctgtgac
tttggaagtgcaaagcagctggtccgaggagaacccaatgtttcgtatatctgttctcgg
tactatagggcaccagagttgatctttggagccactgattatacctctagtatagatgta
tggtctgcaggctgtgtgttggctgagctgttgctaggacaaccaatatttccaggggat
agtggtgtggatcaattggtagaaataatcaaggtcctggggacaccaacaagggagcaa
attagagaaatgaacccaaactacacagaattcaaattccctcaaattaaggcacatcct
tggactaaggattcgtcaggaacaggacatttcacctcaggagttcgggtcttccgacct
cgaactccaccagaggcgattgcactatgtagccgtctgctggagtataccccaactgcc
cgattgacaccactggaagcttgtgcacattcattttttgatgaattacgggacccaaat
gtcaaactaccaaatgggcgagacacacctgcactcttcaacttcaccactcaagaactg
tcaagtaatccacctctagctaccatccttattcctcctcatgctcggattcaagcagct
gcttcaaccccttcaaataccacagcagcctcagatgctaatgctggagaccgtggacag
accaataacgccgcttccgcatcagcttccaactccacctga

DBGET integrated database retrieval system