KEGG   Physeter catodon (sperm whale): 102978925
Entry
102978925         CDS       T06011                                 

Gene name
SOS2
Definition
(RefSeq) son of sevenless homolog 2
  KO
K03099  son of sevenless
Organism
pcad  Physeter catodon (sperm whale)
Pathway
pcad01521  EGFR tyrosine kinase inhibitor resistance
pcad01522  Endocrine resistance
pcad04010  MAPK signaling pathway
pcad04012  ErbB signaling pathway
pcad04014  Ras signaling pathway
pcad04062  Chemokine signaling pathway
pcad04068  FoxO signaling pathway
pcad04072  Phospholipase D signaling pathway
pcad04150  mTOR signaling pathway
pcad04151  PI3K-Akt signaling pathway
pcad04510  Focal adhesion
pcad04540  Gap junction
pcad04630  JAK-STAT signaling pathway
pcad04650  Natural killer cell mediated cytotoxicity
pcad04660  T cell receptor signaling pathway
pcad04662  B cell receptor signaling pathway
pcad04664  Fc epsilon RI signaling pathway
pcad04714  Thermogenesis
pcad04722  Neurotrophin signaling pathway
pcad04810  Regulation of actin cytoskeleton
pcad04910  Insulin signaling pathway
pcad04912  GnRH signaling pathway
pcad04915  Estrogen signaling pathway
pcad04917  Prolactin signaling pathway
pcad04926  Relaxin signaling pathway
pcad04935  Growth hormone synthesis, secretion and action
pcad05034  Alcoholism
pcad05160  Hepatitis C
pcad05161  Hepatitis B
pcad05163  Human cytomegalovirus infection
pcad05165  Human papillomavirus infection
pcad05200  Pathways in cancer
pcad05205  Proteoglycans in cancer
pcad05206  MicroRNAs in cancer
pcad05210  Colorectal cancer
pcad05211  Renal cell carcinoma
pcad05213  Endometrial cancer
pcad05214  Glioma
pcad05215  Prostate cancer
pcad05220  Chronic myeloid leukemia
pcad05221  Acute myeloid leukemia
pcad05223  Non-small cell lung cancer
pcad05224  Breast cancer
pcad05225  Hepatocellular carcinoma
pcad05226  Gastric cancer
pcad05231  Choline metabolism in cancer
Brite
KEGG Orthology (KO) [BR:pcad00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04010 MAPK signaling pathway
    102978925 (SOS2)
   04012 ErbB signaling pathway
    102978925 (SOS2)
   04014 Ras signaling pathway
    102978925 (SOS2)
   04630 JAK-STAT signaling pathway
    102978925 (SOS2)
   04068 FoxO signaling pathway
    102978925 (SOS2)
   04072 Phospholipase D signaling pathway
    102978925 (SOS2)
   04151 PI3K-Akt signaling pathway
    102978925 (SOS2)
   04150 mTOR signaling pathway
    102978925 (SOS2)
 09140 Cellular Processes
  09144 Cellular community - eukaryotes
   04510 Focal adhesion
    102978925 (SOS2)
   04540 Gap junction
    102978925 (SOS2)
  09142 Cell motility
   04810 Regulation of actin cytoskeleton
    102978925 (SOS2)
 09150 Organismal Systems
  09151 Immune system
   04650 Natural killer cell mediated cytotoxicity
    102978925 (SOS2)
   04660 T cell receptor signaling pathway
    102978925 (SOS2)
   04662 B cell receptor signaling pathway
    102978925 (SOS2)
   04664 Fc epsilon RI signaling pathway
    102978925 (SOS2)
   04062 Chemokine signaling pathway
    102978925 (SOS2)
  09152 Endocrine system
   04910 Insulin signaling pathway
    102978925 (SOS2)
   04912 GnRH signaling pathway
    102978925 (SOS2)
   04915 Estrogen signaling pathway
    102978925 (SOS2)
   04917 Prolactin signaling pathway
    102978925 (SOS2)
   04926 Relaxin signaling pathway
    102978925 (SOS2)
   04935 Growth hormone synthesis, secretion and action
    102978925 (SOS2)
  09156 Nervous system
   04722 Neurotrophin signaling pathway
    102978925 (SOS2)
  09159 Environmental adaptation
   04714 Thermogenesis
    102978925 (SOS2)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    102978925 (SOS2)
   05206 MicroRNAs in cancer
    102978925 (SOS2)
   05205 Proteoglycans in cancer
    102978925 (SOS2)
   05231 Choline metabolism in cancer
    102978925 (SOS2)
  09162 Cancer: specific types
   05210 Colorectal cancer
    102978925 (SOS2)
   05225 Hepatocellular carcinoma
    102978925 (SOS2)
   05226 Gastric cancer
    102978925 (SOS2)
   05214 Glioma
    102978925 (SOS2)
   05221 Acute myeloid leukemia
    102978925 (SOS2)
   05220 Chronic myeloid leukemia
    102978925 (SOS2)
   05211 Renal cell carcinoma
    102978925 (SOS2)
   05215 Prostate cancer
    102978925 (SOS2)
   05213 Endometrial cancer
    102978925 (SOS2)
   05224 Breast cancer
    102978925 (SOS2)
   05223 Non-small cell lung cancer
    102978925 (SOS2)
  09165 Substance dependence
   05034 Alcoholism
    102978925 (SOS2)
  09172 Infectious disease: viral
   05161 Hepatitis B
    102978925 (SOS2)
   05160 Hepatitis C
    102978925 (SOS2)
   05163 Human cytomegalovirus infection
    102978925 (SOS2)
   05165 Human papillomavirus infection
    102978925 (SOS2)
  09176 Drug resistance: antineoplastic
   01521 EGFR tyrosine kinase inhibitor resistance
    102978925 (SOS2)
   01522 Endocrine resistance
    102978925 (SOS2)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04990 Domain-containing proteins not elsewhere classified [BR:pcad04990]
    102978925 (SOS2)
Domain-containing proteins not elsewhere classified [BR:pcad04990]
 Pleckstrin homology (PH) domain-containing proteins
  Dbl-Like RhoGEF family proteins
   102978925 (SOS2)
SSDB
Motif
Pfam: RasGEF RasGEF_N RhoGEF Histone PH IQ_SEC7_PH PH_19 PH_13
Other DBs
NCBI-GeneID: 102978925
NCBI-ProteinID: XP_023971777
UniProt: A0A2Y9S2X5
LinkDB
Position
11
AA seq 1332 aa
MQQAPQPYEFFSEENSPKWRGLLVSALRKVQEQVHPNLSANEESLYYIEELIFQLLNKLC
MAQPRTVQDVEERVQKTFPHPIDKWAIADAQSAIEKRKRRNPLLLPVDKIHPSLKEVLGY
KVDYHVSLYIVAVLEYISADILKLAGNYVFNIRHYEISQQDIKVSMCADKVLMDMFDQDD
IGLVSLCEDEPSSSGELNYYDLVRTEIAEERQYLRELNMIIKVFREAFLSDRNLFKPSDI
EKIFSNILDIHELTVKLLGLIEDTVEMTDESSPHPLAGSCFEDLAEEQAFDPYETLSQDI
LSPKFNEHFSKLMARPAVALHFQSIADGFKEAVRYVLPRLMLVPVYHCWHYFELLKQLKA
CSEEHEDRECLNQAITALMNLQGSMDRIYKQYSPRRRPGDPVCPFYNRQLRSKHLAIKKM
NEIQKNIDGWEGKDIGQCCNEFIMEGPLTRIGAKHERHIFLFDGLMISCKSNHSQSRLPG
YSSAEYRLKEKFVMRKVQICDKEDTCECKHAFELVSKDENSIIFAAKSAEEKNNWMAALI
SLHYRSTLDRMLDSVLLKEENEQPLRLPSPEVYRFVVKDSEENIVFEDNLQSRSGIPIIK
GGTVVKLIERLTYHMYADPNFVRTFLTTYRSFCKPQELLSLLIERFEIPEPEPSEADKLA
VEKGEQPISADLKRFRKEYVQPVQLRILNVFRHWVEHHFYDFERDLELLERLESFISSVR
GKAMKKWVESIAKIIKRKKQAQANGISHNITFESPPPPIEWHISRPGQFETFDLMTLHPI
EIARQLTLLESDLYRKVQPSELVGSVWTKEDKEINSPNLLKMIRHTTNLTLWFEKCIVEA
ENFEERVAVLSRIIEILQVFQDLNNFNGVLEIVSAVNSVSVYRLDHTFEALQERKRKILD
DAVELSQDHFKKYLVKLKSINPPCVPFFGIYLTNILKTEEGNNDFLKKKGKDLINFSKRR
KVAEITGEIQQYQNQPYCLRIEPEMRRFFENLNPMGNASEKEFTDYLFNKSLEIEPRNCK
QPPRFPRKSTFSLKSPGIRPNTGRHGSTSGTLRGHPTPLEREPCKISFSRIAETELESTV
SAPTSPNTPSTPPVSASSDLSVFLDVDLNSSCGSNSIFAPVLLPHSKSFFSSCGSLHKLS
EEPLIPPPLPPRKKFDHDASNSKGTMKSDDDPPAIPPRQPPPPKVKPRVPAPTGAFDGPL
HSPPPPPPRDPLPDTPPPVPLRPPEHFINCPFTLQPPPLGHLHRDPDWFRDVSTCPNSPN
TPLSTPSPRVPRRCYVLSSSQNNLAHPQAPPVPPRQNSSPHLPKLPPKTYKRELSHPPLY
RLPLLENAETPQ
NT seq 3999 nt   +upstreamnt  +downstreamnt
atgcagcaggcgccgcagccgtacgagttcttcagcgaagagaacagtccgaaatggcgg
ggactgttggtctcagccctgcggaaggttcaggagcaagtacatcccaatctctcagct
aatgaagagtctctctattatattgaagagctgatttttcagctgcttaataaattatgc
atggcccaaccaaggactgttcaagatgtggaggaacgagttcaaaagacctttcctcat
ccaattgataaatgggctattgctgatgcacagtctgccatagagaaacgaaaacgaaga
aatcctctcttactgcctgtggacaaaatccatccttcattgaaggaagttttagggtac
aaagtggactaccatgtgtcactatatattgtggctgttctagagtatatctcagctgat
attttgaaattggctggtaattatgtttttaatatccgacattatgaaatatcgcaacag
gacattaaagtgtcaatgtgtgcagataaggttttgatggacatgtttgatcaggatgac
ataggcttggtttctctttgtgaagatgaacctagttcttcaggtgaattaaactactat
gaccttgtcagaactgaaattgcagaagaaagacagtacctacgggaactaaatatgatc
ataaaagtatttcgagaagcttttctttctgacagaaacctgtttaaaccttctgatatt
gaaaagattttcagtaacattttagatatacatgaattgaccgtgaaacttttaggttta
attgaagacacagttgaaatgactgatgaaagcagccctcatcccttagctggaagctgt
tttgaagatttagcagaggaacaagcatttgatccttatgaaacattatcacaggatatt
ctttcaccaaaatttaatgaacatttcagtaagttgatggccagacctgcagtggctcta
cactttcagtccattgctgatggttttaaagaggcagttcgttatgtccttccacgcctt
atgctggtgccagtatatcattgttggcactattttgaattattaaagcaattgaaagca
tgtagtgaagagcatgaagacagagaatgtttgaaccaagctattactgctctcatgaat
ctccaaggtagtatggaccgaatttacaagcagtattcacctagacgccgacctggggat
cctgtttgccctttttataatcgtcaattaagaagcaagcacctggctattaaaaaaatg
aatgaaattcagaaaaacatagatggatgggaaggcaaagatattggacagtgttgtaat
gaatttattatggaaggcccattgacaagaattggtgctaaacacgaacggcatattttt
ctctttgatggcttaatgattagctgcaaatccaatcatagccagtcacgccttccagga
tacagtagtgcagaatacagattaaaagaaaaatttgtcatgaggaaagtacaaatatgt
gataaagaagatacttgtgaatgcaaacatgcttttgaattagtatccaaagatgaaaac
agcataatatttgctgctaagtctgctgaagagaaaaataattggatggcagcacttatt
tctcttcattatcgtagtactctagatcgaatgctagattcagtattactgaaggaagaa
aatgaacaaccacttagattaccgagtcctgaagtgtatcgttttgtggtaaaagactct
gaggaaaacattgtttttgaagacaacttgcaaagtagaagtggaatccccattattaaa
ggaggaactgtggtgaaattaattgaaaggttaacatatcacatgtatgcagatcccaat
tttgttcgtacttttcttactacgtatcgttcattttgtaaaccacaggaattgctaagc
ttactgattgaacgatttgaaattccagagccagaaccttctgaagcagataaattggca
gtagagaaaggcgagcagccaatcagtgcagaccttaaaaggtttcgcaaggaatacgtc
caaccagtacaacttaggatcttaaatgtgtttcggcactgggttgaacaccatttttat
gactttgaaagagacttggagttgcttgaaaggctagaatccttcatttcaagtgtaaga
gggaaagctatgaagaaatgggtagagtcaattgctaagatcatcaagaggaagaaacaa
gctcaggcaaatggaataagccataatattacctttgaaagtccacctccaccaattgaa
tggcatatcagcagaccaggacagtttgaaacgtttgatctcatgacacttcatccaata
gaaattgcacgtcagctgacacttttggaatctgatctctacaggaaagttcaaccttca
gaacttgtagggagtgtatggacgaaagaagataaagaaataaattctccaaatttatta
aaaatgattcgccacaccacaaatctcactctctggtttgaaaagtgcattgtggaagca
gaaaattttgaggaacgggtggcagtactaagtagaattatagaaattctgcaagttttt
caagatttgaataatttcaatggtgtattagagatcgtcagtgcagtaaattcagtatca
gtctatagactagatcatacctttgaggcattgcaggaaagaaaaaggaaaattttggat
gatgctgtggaattaagtcaagatcattttaaaaaatatctagtgaaacttaagtcaatc
aatccaccttgtgtgcctttttttggaatatatttaacaaatattctgaagactgaagaa
gggaataatgattttttaaaaaagaaagggaaagatttaatcaatttcagtaagaggagg
aaagtagctgaaattactggagaaattcagcaatatcagaatcaaccttactgtttacgg
atagaaccagaaatgaggaggttctttgaaaaccttaaccccatgggaaatgcttctgaa
aaagagtttacagattatttgttcaacaagtcactagaaattgaaccccgaaactgcaaa
cagccacctcgatttcctaggaaatcaactttctctttaaaatctcctggaataaggcct
aatacaggccgacatggctctacctcaggtactttacgaggtcatccaacaccattagaa
agagaaccatgtaaaataagctttagtcggattgctgaaacagagcttgaatcaacagtg
tcagcaccaacctctccaaatacaccatctactccaccagtatctgcttcttcagacctt
agtgtgtttttagatgtggatctcaacagttcctgtggaagcaatagcatctttgctcca
gtcctcttgcctcattcaaagtctttctttagttcgtgtggtagtttacataagctaagt
gaagagccactgattcctcctccacttcctcctcgaaaaaaatttgatcacgatgcttca
aattccaagggaactatgaaatctgatgatgacccccctgctattccgccaagacagcct
cctcctccaaaggtaaaacccagagttcctgctcctactggtgcatttgacgggcctctg
catagtccaccaccgccgccgccgagagatcctcttcccgatacccctccaccagttccc
cttcggcctccagaacactttataaactgtccatttactcttcagccacctccactggga
catcttcacagagatccagactggttcagagacgttagtacgtgtccaaattctccaaac
actcctcttagcacaccctctccaagggtaccacgtcgatgctatgtgctcagttctagt
caaaataatcttgctcatcctcaagctccccctgttccaccaaggcagaattcaagccct
catctaccaaaactgccaccaaagacttacaaacgggagctttcacaccccccattgtat
agactgcctttgctagaaaatgcagaaactcctcaatga

KEGG   Physeter catodon (sperm whale): 102981677
Entry
102981677         CDS       T06011                                 

Definition
(RefSeq) LOW QUALITY PROTEIN: son of sevenless homolog 2-like
  KO
K03099  son of sevenless
Organism
pcad  Physeter catodon (sperm whale)
Pathway
pcad01521  EGFR tyrosine kinase inhibitor resistance
pcad01522  Endocrine resistance
pcad04010  MAPK signaling pathway
pcad04012  ErbB signaling pathway
pcad04014  Ras signaling pathway
pcad04062  Chemokine signaling pathway
pcad04068  FoxO signaling pathway
pcad04072  Phospholipase D signaling pathway
pcad04150  mTOR signaling pathway
pcad04151  PI3K-Akt signaling pathway
pcad04510  Focal adhesion
pcad04540  Gap junction
pcad04630  JAK-STAT signaling pathway
pcad04650  Natural killer cell mediated cytotoxicity
pcad04660  T cell receptor signaling pathway
pcad04662  B cell receptor signaling pathway
pcad04664  Fc epsilon RI signaling pathway
pcad04714  Thermogenesis
pcad04722  Neurotrophin signaling pathway
pcad04810  Regulation of actin cytoskeleton
pcad04910  Insulin signaling pathway
pcad04912  GnRH signaling pathway
pcad04915  Estrogen signaling pathway
pcad04917  Prolactin signaling pathway
pcad04926  Relaxin signaling pathway
pcad04935  Growth hormone synthesis, secretion and action
pcad05034  Alcoholism
pcad05160  Hepatitis C
pcad05161  Hepatitis B
pcad05163  Human cytomegalovirus infection
pcad05165  Human papillomavirus infection
pcad05200  Pathways in cancer
pcad05205  Proteoglycans in cancer
pcad05206  MicroRNAs in cancer
pcad05210  Colorectal cancer
pcad05211  Renal cell carcinoma
pcad05213  Endometrial cancer
pcad05214  Glioma
pcad05215  Prostate cancer
pcad05220  Chronic myeloid leukemia
pcad05221  Acute myeloid leukemia
pcad05223  Non-small cell lung cancer
pcad05224  Breast cancer
pcad05225  Hepatocellular carcinoma
pcad05226  Gastric cancer
pcad05231  Choline metabolism in cancer
Brite
KEGG Orthology (KO) [BR:pcad00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04010 MAPK signaling pathway
    102981677
   04012 ErbB signaling pathway
    102981677
   04014 Ras signaling pathway
    102981677
   04630 JAK-STAT signaling pathway
    102981677
   04068 FoxO signaling pathway
    102981677
   04072 Phospholipase D signaling pathway
    102981677
   04151 PI3K-Akt signaling pathway
    102981677
   04150 mTOR signaling pathway
    102981677
 09140 Cellular Processes
  09144 Cellular community - eukaryotes
   04510 Focal adhesion
    102981677
   04540 Gap junction
    102981677
  09142 Cell motility
   04810 Regulation of actin cytoskeleton
    102981677
 09150 Organismal Systems
  09151 Immune system
   04650 Natural killer cell mediated cytotoxicity
    102981677
   04660 T cell receptor signaling pathway
    102981677
   04662 B cell receptor signaling pathway
    102981677
   04664 Fc epsilon RI signaling pathway
    102981677
   04062 Chemokine signaling pathway
    102981677
  09152 Endocrine system
   04910 Insulin signaling pathway
    102981677
   04912 GnRH signaling pathway
    102981677
   04915 Estrogen signaling pathway
    102981677
   04917 Prolactin signaling pathway
    102981677
   04926 Relaxin signaling pathway
    102981677
   04935 Growth hormone synthesis, secretion and action
    102981677
  09156 Nervous system
   04722 Neurotrophin signaling pathway
    102981677
  09159 Environmental adaptation
   04714 Thermogenesis
    102981677
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    102981677
   05206 MicroRNAs in cancer
    102981677
   05205 Proteoglycans in cancer
    102981677
   05231 Choline metabolism in cancer
    102981677
  09162 Cancer: specific types
   05210 Colorectal cancer
    102981677
   05225 Hepatocellular carcinoma
    102981677
   05226 Gastric cancer
    102981677
   05214 Glioma
    102981677
   05221 Acute myeloid leukemia
    102981677
   05220 Chronic myeloid leukemia
    102981677
   05211 Renal cell carcinoma
    102981677
   05215 Prostate cancer
    102981677
   05213 Endometrial cancer
    102981677
   05224 Breast cancer
    102981677
   05223 Non-small cell lung cancer
    102981677
  09165 Substance dependence
   05034 Alcoholism
    102981677
  09172 Infectious disease: viral
   05161 Hepatitis B
    102981677
   05160 Hepatitis C
    102981677
   05163 Human cytomegalovirus infection
    102981677
   05165 Human papillomavirus infection
    102981677
  09176 Drug resistance: antineoplastic
   01521 EGFR tyrosine kinase inhibitor resistance
    102981677
   01522 Endocrine resistance
    102981677
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04990 Domain-containing proteins not elsewhere classified [BR:pcad04990]
    102981677
Domain-containing proteins not elsewhere classified [BR:pcad04990]
 Pleckstrin homology (PH) domain-containing proteins
  Dbl-Like RhoGEF family proteins
   102981677
SSDB
Motif
Pfam: RasGEF RasGEF_N RhoGEF PH Histone PH_13
Other DBs
NCBI-GeneID: 102981677
NCBI-ProteinID: XP_023980472
UniProt: A0A2Y9SSQ6
LinkDB
Position
8
AA seq 1325 aa
MPQAPQPYEFFSAENSPKWRGLLVSALPKVQEQVHPNLSADEEPIFQLLNKLCMAQPRTV
QDVAEVQKTFSHPVDEWAIADAQSATEKRKRRNPLLLPVDKIHPSLKEVLGYKVDYHVSL
YSVAVLEYISAGILKLAGNYVFNIRHYEISQQDIKVSVCADKVLMDMFDQDDIGLVSLCE
DEPSSSGELNYYDLVRTEIAEERQYLRKLNMIIKVFRKVFLSDRKLFKSSDIEKVFSNIL
DIHELTVKLLGLIEDTVEMTDESSPHPLAGSCFEDLTEEQAFDPYETLSQDILSPKFNEH
FSKLMAIPAVALQFQSIADGFKEAVYYVLPHLMLVPVYHCWHYFELLKQLKACSEEHEDR
ECLNQAITALMNLQGSLDRIYKQYSPRCXPGDPVYPFYNHQLRSKHLAIKKMNEIQKNID
GWEGKDIGQCCNEFIMEGPLTRIGAKHEWHIFLFDGCLMISCKPNHSQSHLPGYHSTEYR
LKEKFVMRKIQICDKEDTCECKHAFELVSKDENSIIFAARSAEEKNNWMAALISLHYRST
LDQMLDSVLLKEENEQPLKLPSPEVYRFVVKDSXENIVFEDNLQSRSGIPIIKGGAVVKL
IERLTYHMYADPNFVRTFLTMYRSFCKPQELLSLLIERFEIPEPEPTEADKLAVEKGEQP
ISADLKRFHKEYVQPVQLRILNVFRHWVEHHYYHFERDLELLERLESFISSVRGKAMKKW
VESIAKIIKRKKQAQANGISHNITFQSLPPPTEWHISRPGQFETFDLMTLHPIEIARQLT
LLESDLYSKVQPSELVGHVWTKEDKEIDSPNLLKMIHHTTNLTLWFEKCIVEAENFEERV
AVLSRIIEILQVFQDLNNFNGVLEIVSAVNSVSVYRLDHTSEERKRKILDEAVELSQDHX
KKYLVKLKSINPPCVPFFGIYLTNILKTEEGNNDFLKKKGKDLINFSKRRKRRKVPEITG
EIQQYQNQPYCLWIEPEMRRFFENLNPMGNASEKEFTDYLFNKSLEIEPGNSKQPPRFPR
NSTFSLKSPGIRPNTGRHGSTSGTLWGRPTPLERELCKISFSRIAETELESTVSAPTSPN
TPSTPPVSASSDLSVFLDVDLSSSCGSNSIFAPVLLPHSESFFSSCGSLHKLSEEPLIPP
ALSPRNKFDHDASNSKGTMKSDDDPPAILPRQPPPPKVKPRVPVPTGAFDGPLHSPPPPP
PRDPFPNTPPPVPLRPPEHFINCPFTLQPPPLGHLHRDPDWFRDVSTCPNSPNTPLSTPS
PRVPRXCYVLSSSQNNLAHPQAPPVPPRQDSSPHLPKLPPKTYKRELSHPPLYRLPLLEN
AETPQ
NT seq 3978 nt   +upstreamnt  +downstreamnt
atgccgcaggcgccgcagccgtacgagttcttcagcgcagagaacagtccgaaatggcgg
ggactgttggtctcggccctgccgaaggttcaggagcaagtacatcccaatctctcagct
gatgaagagccgatttttcagctgcttaataaattatgcatggcccaaccaaggactgtt
caagatgtggcggaagttcaaaagaccttttctcatccagtggatgaatgggctattgct
gatgcacagtctgccacagagaaacgaaaacgaagaaatcctctcttactgcctgtggac
aaaatccatccttcattgaaggaagttttagggtacaaagtggactaccatgtgtcccta
tatagtgtggctgtactagagtatatctcagctggtattttgaaattggctggtaattat
gtttttaatatccgacattatgaaatatcccaacaggacattaaagtgtcagtgtgtgca
gataaggttttgatggacatgtttgatcaggatgacataggcttggtttctctttgtgaa
gatgaacctagttcttcaggtgaattaaactactatgaccttgtcagaactgaaattgca
gaagaaagacagtatctacggaaactaaatatgatcataaaagtgtttcgaaaggttttt
ctttctgacagaaagctgtttaaatcttctgatattgaaaaggttttcagtaacatttta
gatatacatgaattgaccgtgaaacttttaggtctaattgaagacacagttgaaatgact
gatgaaagcagccctcatcccttagctggaagctgttttgaagatttgacagaggaacaa
gcatttgatccttatgaaacattatcacaggatattctttcaccaaaatttaatgaacat
ttcagtaagttgatggccatacctgcagtggctctacagtttcagtccattgctgatggt
tttaaagaggcagtttattatgtccttccacaccttatgctggtgccagtatatcattgt
tggcactattttgaattattaaagcaattgaaagcatgtagtgaagagcatgaagacaga
gaatgtttgaaccaagctattactgctctcatgaatctccaaggtagtttggaccgaatt
tacaagcaatattcacctagatgctgacctggggatcctgtttaccctttttataatcat
caattaagaagcaagcacctggctattaaaaaaatgaatgaaattcagaaaaacatagat
ggatgggaaggcaaagatattggacagtgttgtaatgaatttattatggaaggtccattg
acaagaattggtgccaaacacgaatggcatatttttctctttgatggctgcttaatgatt
agctgcaaacccaatcatagccagtcacaccttccaggataccatagtacagaatacaga
ttaaaagaaaaatttgtcatgaggaaaatacaaatatgtgataaagaagatacttgtgag
tgcaaacatgcttttgaattagtatccaaagatgaaaacagcataatatttgctgctagg
tctgctgaagagaaaaataattggatggcagcacttatttctcttcattatcgtagtact
ctagatcaaatgctagattcagtattactgaaggaagaaaatgaacaaccacttaaatta
ccgagtcctgaagtgtatcgttttgtggtaaaagactctngagaaaacattgtttttgaa
gacaacttgcaaagcagaagtggaatccccattattaaaggaggagctgtggtgaaatta
attgaaaggttaacgtatcacatgtatgcagatcccaattttgttcgcacttttcttact
atgtatcgttcattttgtaaaccacaggaattgctaagcttactgattgaacgatttgaa
attccagagccagaacctactgaagcagataaattggcagtagagaaaggcgagcagccg
atcagtgcagaccttaaaaggtttcacaaggaatacgtccaaccagtacaacttaggatc
ttaaatgtgtttcggcactgggtcgaacaccattattatcactttgaaagagacttggag
ttgcttgaaagactagaatccttcatttcaagtgtaagagggaaagctatgaagaaatgg
gtagagtcaattgctaagatcatcaagaggaagaaacaagctcaggcaaatggaataagc
cataatattacctttcaaagtctgccaccaccaaccgaatggcatatcagcagaccagga
cagtttgaaacgtttgatctcatgacacttcatccaatagaaattgcacgtcagctgaca
cttttggaatctgatctctacagcaaagttcaaccttctgaacttgtagggcatgtatgg
accaaagaagataaagaaatagattctccaaatttattaaaaatgattcaccacaccaca
aatctcactctctggtttgaaaagtgcattgtggaagcagaaaattttgaggaacgggtg
gcagtactaagtagaattatagaaattctgcaagtttttcaagatttgaataatttcaat
ggtgtattagagattgtcagtgcagtaaattcagtatcagtctatagactagatcatacc
tctgaggaaagaaaaaggaaaattttggatgaagctgtggaattaagtcaagatcattaa
aaaaaatatctagtgaaacttaagtcaatcaatccaccttgtgtgcctttttttggaata
tatttaacaaatattctgaagactgaagaagggaataatgattttttaaaaaagaaaggg
aaagatttaatcaatttcagtaagaggaggaaaaggaggaaagtacctgaaattactgga
gaaattcagcaatatcagaatcaaccttactgtttatggatagaaccagaaatgaggagg
ttctttgaaaaccttaaccccatgggaaatgcttctgaaaaagagtttacagattatttg
ttcaacaagtcactagaaattgaacccggaaactccaaacagccacctcgatttcctagg
aactcaactttctctttaaaatctcctggaataaggcctaatacaggccgacatggctct
acctcaggtactttatggggtcgtccaacaccattagaaagagaactgtgtaaaataagc
tttagtcggattgctgaaacagagcttgaatcaacagtgtcagcaccaacctctccaaat
acaccatctactccaccagtatctgcttcttcagaccttagtgtgtttttagatgtggat
ctcagcagttcctgtggaagcaatagcatctttgctccagtcctcttgcctcattcagag
tctttctttagttcgtgtggtagtttacataaactaagtgaagagccactgattcctcct
gcactttctcctcgaaacaaatttgatcatgatgcttcaaattccaagggaactatgaaa
tctgatgatgacccccctgctattctgccaagacagcctcctcctccaaaggtaaaaccc
agagttcctgtgcctactggtgcatttgacgggcctctgcatagtccaccgccgccgccg
ccgagagatccttttcccaatacccctccaccagttccccttcggcctccagaacacttc
ataaactgtccgtttactcttcaaccacctccactgggacatcttcacagagatccagac
tggttcagagatgttagtacgtgtccaaattctccaaacactcctcttagcacaccctct
ccaagggtaccacgttgatgctatgtgctcagttctagtcaaaataatcttgctcatcct
caagctccccctgttccaccaaggcaggattcaagccctcacctaccaaaactgccacca
aagacttacaaacgggagctttcgcaccccccattgtatagactgcctttgctagaaaat
gcagaaactcctcaatga

KEGG   Physeter catodon (sperm whale): 102991639
Entry
102991639         CDS       T06011                                 

Gene name
SOS1
Definition
(RefSeq) son of sevenless homolog 1 isoform X1
  KO
K03099  son of sevenless
Organism
pcad  Physeter catodon (sperm whale)
Pathway
pcad01521  EGFR tyrosine kinase inhibitor resistance
pcad01522  Endocrine resistance
pcad04010  MAPK signaling pathway
pcad04012  ErbB signaling pathway
pcad04014  Ras signaling pathway
pcad04062  Chemokine signaling pathway
pcad04068  FoxO signaling pathway
pcad04072  Phospholipase D signaling pathway
pcad04150  mTOR signaling pathway
pcad04151  PI3K-Akt signaling pathway
pcad04510  Focal adhesion
pcad04540  Gap junction
pcad04630  JAK-STAT signaling pathway
pcad04650  Natural killer cell mediated cytotoxicity
pcad04660  T cell receptor signaling pathway
pcad04662  B cell receptor signaling pathway
pcad04664  Fc epsilon RI signaling pathway
pcad04714  Thermogenesis
pcad04722  Neurotrophin signaling pathway
pcad04810  Regulation of actin cytoskeleton
pcad04910  Insulin signaling pathway
pcad04912  GnRH signaling pathway
pcad04915  Estrogen signaling pathway
pcad04917  Prolactin signaling pathway
pcad04926  Relaxin signaling pathway
pcad04935  Growth hormone synthesis, secretion and action
pcad05034  Alcoholism
pcad05160  Hepatitis C
pcad05161  Hepatitis B
pcad05163  Human cytomegalovirus infection
pcad05165  Human papillomavirus infection
pcad05200  Pathways in cancer
pcad05205  Proteoglycans in cancer
pcad05206  MicroRNAs in cancer
pcad05210  Colorectal cancer
pcad05211  Renal cell carcinoma
pcad05213  Endometrial cancer
pcad05214  Glioma
pcad05215  Prostate cancer
pcad05220  Chronic myeloid leukemia
pcad05221  Acute myeloid leukemia
pcad05223  Non-small cell lung cancer
pcad05224  Breast cancer
pcad05225  Hepatocellular carcinoma
pcad05226  Gastric cancer
pcad05231  Choline metabolism in cancer
Brite
KEGG Orthology (KO) [BR:pcad00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04010 MAPK signaling pathway
    102991639 (SOS1)
   04012 ErbB signaling pathway
    102991639 (SOS1)
   04014 Ras signaling pathway
    102991639 (SOS1)
   04630 JAK-STAT signaling pathway
    102991639 (SOS1)
   04068 FoxO signaling pathway
    102991639 (SOS1)
   04072 Phospholipase D signaling pathway
    102991639 (SOS1)
   04151 PI3K-Akt signaling pathway
    102991639 (SOS1)
   04150 mTOR signaling pathway
    102991639 (SOS1)
 09140 Cellular Processes
  09144 Cellular community - eukaryotes
   04510 Focal adhesion
    102991639 (SOS1)
   04540 Gap junction
    102991639 (SOS1)
  09142 Cell motility
   04810 Regulation of actin cytoskeleton
    102991639 (SOS1)
 09150 Organismal Systems
  09151 Immune system
   04650 Natural killer cell mediated cytotoxicity
    102991639 (SOS1)
   04660 T cell receptor signaling pathway
    102991639 (SOS1)
   04662 B cell receptor signaling pathway
    102991639 (SOS1)
   04664 Fc epsilon RI signaling pathway
    102991639 (SOS1)
   04062 Chemokine signaling pathway
    102991639 (SOS1)
  09152 Endocrine system
   04910 Insulin signaling pathway
    102991639 (SOS1)
   04912 GnRH signaling pathway
    102991639 (SOS1)
   04915 Estrogen signaling pathway
    102991639 (SOS1)
   04917 Prolactin signaling pathway
    102991639 (SOS1)
   04926 Relaxin signaling pathway
    102991639 (SOS1)
   04935 Growth hormone synthesis, secretion and action
    102991639 (SOS1)
  09156 Nervous system
   04722 Neurotrophin signaling pathway
    102991639 (SOS1)
  09159 Environmental adaptation
   04714 Thermogenesis
    102991639 (SOS1)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    102991639 (SOS1)
   05206 MicroRNAs in cancer
    102991639 (SOS1)
   05205 Proteoglycans in cancer
    102991639 (SOS1)
   05231 Choline metabolism in cancer
    102991639 (SOS1)
  09162 Cancer: specific types
   05210 Colorectal cancer
    102991639 (SOS1)
   05225 Hepatocellular carcinoma
    102991639 (SOS1)
   05226 Gastric cancer
    102991639 (SOS1)
   05214 Glioma
    102991639 (SOS1)
   05221 Acute myeloid leukemia
    102991639 (SOS1)
   05220 Chronic myeloid leukemia
    102991639 (SOS1)
   05211 Renal cell carcinoma
    102991639 (SOS1)
   05215 Prostate cancer
    102991639 (SOS1)
   05213 Endometrial cancer
    102991639 (SOS1)
   05224 Breast cancer
    102991639 (SOS1)
   05223 Non-small cell lung cancer
    102991639 (SOS1)
  09165 Substance dependence
   05034 Alcoholism
    102991639 (SOS1)
  09172 Infectious disease: viral
   05161 Hepatitis B
    102991639 (SOS1)
   05160 Hepatitis C
    102991639 (SOS1)
   05163 Human cytomegalovirus infection
    102991639 (SOS1)
   05165 Human papillomavirus infection
    102991639 (SOS1)
  09176 Drug resistance: antineoplastic
   01521 EGFR tyrosine kinase inhibitor resistance
    102991639 (SOS1)
   01522 Endocrine resistance
    102991639 (SOS1)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04990 Domain-containing proteins not elsewhere classified [BR:pcad04990]
    102991639 (SOS1)
Domain-containing proteins not elsewhere classified [BR:pcad04990]
 Pleckstrin homology (PH) domain-containing proteins
  Dbl-Like RhoGEF family proteins
   102991639 (SOS1)
SSDB
Motif
Pfam: RasGEF RasGEF_N RhoGEF Histone PH PH_19 PH_10 IQ_SEC7_PH PH_13
Other DBs
NCBI-GeneID: 102991639
NCBI-ProteinID: XP_023974332
UniProt: A0A2Y9SAH3
LinkDB
Position
12
AA seq 1333 aa
MQAQQLPYEFFSEENAPKWRGLLVPALKKVQGQVHPTLESSDDALQYVEELILQLLNMLC
QAQPRSASDVEERVQKSFPHPIDKWAIADAQSAIEKRKRRNPLSLPVEKIHPLLKEVLGY
KIDHQVSVYIVAVLEYISADILKLVGNYVRNIRHYEITKQDIKVAMCADKVLMDMFHQDV
EDINILSLTDEEPSTSGEQTYYDLVKAFMAEIRQYIRELNLIIKVFREPFVSNSKLFSAN
DVENIFSRIVDIHELSVKLLGHIEDTVEMTDEGSPHPLVGSCFEDLAEELAFDPYESYAR
DILRPGFHDRFLSQLSKPGAALYLQSIGEGFKEAVQYVLPRLLLAPVYHCLHYFELLKQL
EEKSEDQEDKECLKQAITALLNVQSGMEKICSKSLAKRRLSESACRFYSQQMKGKQLAIK
KMNEIQKNIDGWEGKDIGQCCNEFIMEGTLTRVGAKHERHIFLFDGLMICCKSNHGQPRL
PGASNAEYRLKEKFFMRKVQINDKDDTNEYKHAFEIILKDENSVIFSAKSAEEKNNWMAA
LISLQYRSTLERMLDVTMLQEEKEEQMRLPSADVYRFAEPDSEENIIFEENVQPKAGIPI
IKAGTVIKLIERLTYHMYADPNFVRTFLTTYRSFCKPQELLSLIIERFEIPEPEPTEADR
IAIENGDQPLSAELKRFRKEYIQPVQLRVLNVCRHWVEHHFYDFERDADLLQRMEEFIGT
VRGKAMKKWVESITKIIQRKKIARDNGPGHNITFQSSPPTVEWHISRPGHIETFDLLTLH
PIEIARQLTLLESDLYRAVQPSELVGSVWTKEDKEINSPNLLKMIRHTTNLTLWFEKCIV
ETENLEERVAVVSRIIEILQVFQELNNFNGVLEVVSAMNSSPVYRLDHTFEQIPSRQKKI
LEEAHELSEDHYKKYLAKLRSINPPCVPFFGIYLTNILKTEEGNPEVLKRHGKELINFSK
RRKVAEITGEIQQYQNQPYCLRVESDIKRFFENLNPMGNSMEKEFTDYLFNKSLEIEPRN
PKPLPRFPKKYSYPLKSPGVRPSNPRPGTMRHPTPLQQEPRKISYSRIPESETESTASAP
NSPRTPLTPPPASGASSTTDVCSVFDSDHSSPFHSSSDTIFIQVTLPHGPRSASVSSISL
TKSTDEVPVPPPVPPRRRPESAPAESSPSKIMSKHLDSPPAIPPRQPTSKAYSPRYSVSD
RTSISDPPESPPLLPPREPVRTPDVFSSSPLHLQPPPLGKKSDHSNAFFPNSPSPFTPPP
PQTPSPHGTRRHLPSPPLTQEVDLHSIAGPPIPPRQSTSQHIPKLPPKTYKREHTHPSMH
RDGPPLLENAHSS
NT seq 4002 nt   +upstreamnt  +downstreamnt
atgcaggcgcagcagctgccgtacgagtttttcagcgaggagaacgcgcccaagtggcgg
gggctgctggtgcctgcgctgaaaaaggttcaggggcaagttcatcctactcttgagtct
agtgatgatgctcttcagtatgttgaagaattaattttgcagttattaaatatgctatgc
caagctcagccccgaagtgcttcagatgtagaggaacgtgttcaaaaaagtttccctcat
ccaattgataagtgggcaatagctgatgcccagtcggctattgaaaagaggaagcgaaga
aaccctttatctctcccagtagaaaaaattcatcctttgttaaaggaggtcctaggttat
aaaattgaccaccaggtttctgtttacatagtagcagtattagaatacatttctgcagac
attttaaagctggtggggaattatgtgcgaaatatacggcattatgaaattacaaaacaa
gatattaaagtggcaatgtgtgctgataaggtattgatggatatgtttcatcaagatgta
gaagatataaatatattatctttaactgatgaagagccttccacctcaggagagcaaact
tattatgatttggtaaaagcatttatggcagaaattcgacaatacataagggaacttaat
ttaattataaaagtttttagagagccctttgtctccaattcaaaattgttttcagctaat
gatgtagaaaatatatttagtcgtatagtggatatacatgaacttagtgtaaagttactg
ggccatatagaagatactgtagaaatgacagatgaaggcagtccccatccattagtagga
agttgctttgaagacttagcagaggaactggcatttgatccatatgaatcatatgctcga
gatattttacgacctggttttcatgatcgtttccttagtcagttatcaaagcctggagcg
gcactctatttgcagtcaataggcgaaggtttcaaagaagctgttcagtatgttttaccc
aggctacttctagcccctgtttaccactgtctacattactttgaacttctgaagcagtta
gaagaaaagagtgaagatcaagaagacaaggaatgtttgaaacaagcaataacagctttg
cttaatgttcagagtggtatggaaaaaatctgttctaaaagtcttgcaaaacgaagactg
agtgaatctgcatgtcggttttatagtcagcaaatgaaggggaaacaactagcaatcaag
aaaatgaacgagattcagaagaatattgatggttgggagggaaaagacattggacagtgt
tgcaatgagtttataatggaaggaactcttacacgtgtaggagccaaacatgagagacac
atatttctctttgatggcttaatgatttgctgtaaatcaaatcatgggcagccaagactt
cctggtgctagcaatgcagaatatcgtcttaaagaaaagttttttatgagaaaggtacaa
attaatgacaaggatgacaccaatgagtacaagcatgcttttgaaataattttaaaagat
gaaaatagcgttatattttctgccaagtcagctgaagagaaaaacaattggatggcagca
ttaatatctttacagtaccggagtacactggaaaggatgcttgatgtgacaatgctacag
gaagaaaaggaggagcagatgaggctccctagtgctgatgtttatagatttgcagagcct
gactctgaagaaaatatcatatttgaagaaaacgtgcagcccaaagctggaattccaatt
atcaaagcaggaactgttattaaacttatagagaggctcacataccatatgtacgcagat
cccaattttgttcggacatttcttacaacatatagatccttttgtaaacctcaagaacta
ctgagtcttataatagaaaggtttgaaattccagagcctgagccaacagaagctgatcgc
atagctatagagaatggagatcagcccttgagtgcagaactaaaaaggtttagaaaagaa
tatatacagcctgtacaactgcgagtattaaatgtatgtcggcactgggtagagcaccac
ttctacgattttgaaagagatgcagatcttttgcagcgaatggaggaatttattggaaca
gtaagaggtaaagcaatgaaaaagtgggttgaatccatcactaaaataatccaaaggaaa
aaaattgcaagagacaatggaccaggtcataatattacatttcagagttcgcctcccaca
gttgagtggcatataagcagacctgggcacatagagacttttgacctgctcaccttacac
ccaatagaaattgctcgacaactcactttacttgaatcagatctatatcgagctgtacag
ccatcagaattagttggaagtgtgtggacaaaggaagacaaagaaattaattctcctaat
cttctgaaaatgatccggcataccactaatctcactctgtggtttgagaaatgtattgta
gaaactgaaaacttagaagaaagagtagctgtggtgagtcgaataattgagattctgcaa
gtctttcaagagctgaacaacttcaatggtgtccttgaggttgtcagtgctatgaactca
tcacctgtatacagactagaccacacgtttgagcaaataccaagtcgccaaaagaaaatt
ttagaagaagctcatgaactaagtgaagatcactataagaaatatttggcaaaactcagg
tctattaatccaccatgtgtgcctttctttggaatttatctaactaatatcttgaaaaca
gaagaaggcaaccctgaggtcctaaaaaggcatgggaaagagcttataaactttagcaaa
aggaggaaagtagcagaaataacaggcgagatccagcagtaccaaaatcagccttattgt
ttacgagtagaatcagatatcaaaaggttctttgaaaacttgaatccaatgggaaatagt
atggaaaaagaatttacagattatcttttcaacaaatccctagaaatagaaccacgaaac
cctaagcctctcccaagatttccaaaaaaatatagctatcccctaaaatctcctggtgtt
cgtccatcaaacccaagaccaggtactatgagacatcccacacctctgcagcaagagcca
aggaaaattagttatagtaggatccctgaaagtgaaacagaaagtacagcatctgcacca
aattctccaagaacaccgttaacacctcctcctgcttctggtgcttctagtaccacagat
gtttgcagcgtatttgattctgatcattcaagcccttttcactcaagcagcgataccatc
tttatccaagttacactgccccatggcccaagatctgcttcagtatcatctataagttta
accaagagcactgatgaagtgcctgtcccccctcctgttcctccacgaagacgaccagaa
tctgccccagcggaatcttcgccatctaagatcatgtctaagcatttggacagcccccca
gcaattcctcctaggcaacccacatcaaaagcctattcaccacgatattcagtatcagac
cggacctctatatcagatcctcctgaaagccctcccttattacctccacgagaacctgtg
aggacacctgatgttttctcaagctcaccactacatctccaacctccccctttgggcaaa
aaaagtgaccatagtaatgccttcttcccaaacagcccttccccctttacaccacctcct
cctcaaacaccttctcctcatggcacaagaaggcatctgccatcaccaccactgacacaa
gaagtggaccttcattccattgctgggccgcctattcctccacgacaaagcacttctcaa
catatccctaaactccctccaaaaacttacaaaagggagcatacacacccatccatgcac
agagatggaccaccactgttggagaatgcccattcttcctga

DBGET integrated database retrieval system