KEGG   Physeter catodon (sperm whale): 102978946
Entry
102978946         CDS       T06011                                 

Gene name
PLD2
Definition
(RefSeq) phospholipase D2
  KO
K01115  phospholipase D1/2 [EC:3.1.4.4]
Organism
pcad  Physeter catodon (sperm whale)
Pathway
pcad00564  Glycerophospholipid metabolism
pcad00565  Ether lipid metabolism
pcad01100  Metabolic pathways
pcad04014  Ras signaling pathway
pcad04024  cAMP signaling pathway
pcad04071  Sphingolipid signaling pathway
pcad04072  Phospholipase D signaling pathway
pcad04144  Endocytosis
pcad04666  Fc gamma R-mediated phagocytosis
pcad04724  Glutamatergic synapse
pcad04912  GnRH signaling pathway
pcad04928  Parathyroid hormone synthesis, secretion and action
pcad05200  Pathways in cancer
pcad05212  Pancreatic cancer
pcad05231  Choline metabolism in cancer
Brite
KEGG Orthology (KO) [BR:pcad00001]
 09100 Metabolism
  09103 Lipid metabolism
   00564 Glycerophospholipid metabolism
    102978946 (PLD2)
   00565 Ether lipid metabolism
    102978946 (PLD2)
 09130 Environmental Information Processing
  09132 Signal transduction
   04014 Ras signaling pathway
    102978946 (PLD2)
   04072 Phospholipase D signaling pathway
    102978946 (PLD2)
   04071 Sphingolipid signaling pathway
    102978946 (PLD2)
   04024 cAMP signaling pathway
    102978946 (PLD2)
 09140 Cellular Processes
  09141 Transport and catabolism
   04144 Endocytosis
    102978946 (PLD2)
 09150 Organismal Systems
  09151 Immune system
   04666 Fc gamma R-mediated phagocytosis
    102978946 (PLD2)
  09152 Endocrine system
   04912 GnRH signaling pathway
    102978946 (PLD2)
   04928 Parathyroid hormone synthesis, secretion and action
    102978946 (PLD2)
  09156 Nervous system
   04724 Glutamatergic synapse
    102978946 (PLD2)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    102978946 (PLD2)
   05231 Choline metabolism in cancer
    102978946 (PLD2)
  09162 Cancer: specific types
   05212 Pancreatic cancer
    102978946 (PLD2)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04131 Membrane trafficking [BR:pcad04131]
    102978946 (PLD2)
Enzymes [BR:pcad01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.4  Phosphoric-diester hydrolases
    3.1.4.4  phospholipase D
     102978946 (PLD2)
Membrane trafficking [BR:pcad04131]
 Exocytosis
  Calcium ion-dependent exocytosis
   Phospholipases
    102978946 (PLD2)
 Endosome - Golgi transport
  Others
   Others
    102978946 (PLD2)
SSDB
Motif
Pfam: PX PLDc_2 PLDc PH PH_2
Other DBs
NCBI-GeneID: 102978946
NCBI-ProteinID: XP_007109233
UniProt: A0A2Y9EUG5
LinkDB
Position
14
AA seq 933 aa
MAATSESLFPSGGDLDSSQLQMEPDEVDTLKEGEDPADRMHPFLAIYDLQPLKTHPLVFA
PGVPVIAQVVGTERYTSGSKVGTCTLYSVRLTHGDFTWTTKKKFRHFQELHRDLLRHKVL
MSLLPLARFAVAYSPAPEANNREMPSLPRAGPEGSARHASSKQKYLENYLNRLLTMSFYR
NYHAMTEFLEVSQLSFIPDLGSKGLEGVIRKRSGGHRVPGLTCCGRDQVCYHWSKRWLVV
KDSFLLYMSLETSAITYVQLFDPGFEVQVGKRSTEARYGVRIDTSHRSLILKCSSYRQAR
WWAQEITELAQGPGRDFVRLHRHESYAPPRPGTLARWFVNGAGYFAAAADAILQAQEEIF
ITDWWLSPEIYLKRPAHSDDWRLDIMLKKKAEEGVRVSVLLFKEVELALTINSGYSKKVL
MLLHPNIKVMRHPNQVTLWAHHEKLLVVDQVVAFLGGLDLAYGRWDDLQYRLTDLGDSSA
SAAPQPPTARSDPPATPDLSHNQLFWLGKDYSNLITKDWVQLDRPFEDFIDRETTPRMPW
RDVGVVVHGSPARDLARHFIQRWNFTKTTKAKYKIPMYPYLLPKSTSTANQLPFMLPGVQ
CTTVQVLRSVDHWSAGTLENSILNAYLHTIRESQHFLYIENQFFISCSDGRTVLNKVGDE
IVDRILKAHKQGQCFRVYMLLPLLPGFEGDISTGGGNSMQAILHFTYRTLCRGEYSMLHR
LKAAMGTAWRDYISICGLRTHGELGRHPVSELIYIHSKMLIADDRTVIIGSANINDRSLL
GKRDSELAVLIEDTEMEASLMNGVEYQAGRFALSLRKHCFSVILGADARPDLDLRDPVCD
DFFQSWQDTAESNANIYEQIFRCLPSNATRSLRALREYVAVEPLATVSPPLARSELTQVQ
GHLVHFPLKFLEDESLLPTLGSKEGMIPLEVWT
NT seq 2802 nt   +upstreamnt  +downstreamnt
atggcggcgacctccgagagcctcttcccctctgggggtgacctggactccagccagtta
cagatggagcccgatgaggtggacactctgaaggagggagaggacccagctgaccggatg
cacccctttctggccatctacgacctccagcctctgaaaactcaccccttggtgtttgcc
cctggggttcccgtcatagcccaggtggtgggcactgaaagatacaccagtggatccaag
gtgggcacctgcactctgtattctgtccgcttgactcacggtgactttacctggacaacc
aagaagaagttccgtcatttccaggaattgcatcgggacctcctgagacacaaagtcttg
atgagtctgctccctctggctcgctttgccgttgcctattctccagccccagaggcaaac
aacagagagatgccctctctaccccgagcaggtcctgagggctccgccagacatgcatcc
agcaaacagaaatacctggagaattacctcaaccgcctcctgaccatgtctttctaccgc
aactaccacgccatgacagagtttctggaagtcagtcagctgtcctttatcccagacctt
ggatccaaaggactggagggggtgatccggaagcgctcaggtggccaccgtgttcctggc
ctcacctgctgtggccgagaccaagtttgttatcactggtccaagcggtggctggtggta
aaggactccttcctgctgtacatgagcctcgagaccagcgccatcacatatgttcagctc
ttcgaccctgggttcgaggtacaggtggggaaaaggagcacagaggcaaggtatggggtc
cggatcgacacctcccacaggtctttgattctcaagtgcagcagctaccggcaggcacgg
tggtgggcccaggagatcactgagctggcccagggcccgggcagagactttgtacggctg
caccggcacgaaagctacgctccaccccggcctgggaccctggcccggtggtttgtgaat
ggggcaggttactttgctgctgcagctgatgccatcctgcaggctcaagaagagattttc
atcacagactggtggttgagccctgagatttacctgaagcgtccggcccattcagatgac
tggagactggacattatgctcaagaagaaggcggaggagggtgtccgggtgtccgtactg
ctgtttaaggaagtggagttggccttgaccatcaacagtggctatagcaagaaggttctg
atgctactgcatcccaacataaaggtgatgcgccacccaaaccaggtgactctgtgggcc
catcatgagaagctcctggtggtggaccaagtagtggccttcttgggggggctggacctc
gcctatgggcgctgggatgacctgcagtacaggctgaccgaccttggggactcctctgcg
tcagctgccccccagcctcccaccgcacgctcagaccctccagctacaccagacctctct
cacaaccaactcttctggctgggcaaggactacagcaatcttatcactaaggactgggtc
cagctggatcggccttttgaggatttcattgacagggagaccacaccccggatgccatgg
cgggatgtcggggtggtggtccatggctcacccgccagggaccttgcccggcacttcatc
cagcgctggaatttcaccaagaccaccaaggccaagtacaagatacctatgtacccctac
ctgctgcccaagtccaccagcaccgcaaaccagctccctttcatgctcccgggggtgcag
tgcaccaccgtgcaggtcttgcggtcagtggaccactggtcagcggggaccttggagaac
tccatcctcaatgcctacctgcacaccatcagggagagccagcacttcctctacattgag
aatcaattcttcattagctgctcagatgggcggacggtgctgaacaaggtgggcgatgag
attgtggacagaatcctgaaggcccacaaacaggggcagtgcttccgagtctacatgctt
ttgcccctgctccccgggttcgagggcgacatctccacaggcggcggtaactccatgcag
gccattctgcacttcacttacaggacgctatgtcgtggggaatattcaatgctacatcgc
ctcaaagcagccatggggacagcgtggcgggactacatttccatctgtgggcttcgcaca
cacggagagctgggtaggcacccggtctcagagctcatctacatccacagcaagatgctc
attgcagatgaccggacagtcatcattggctccgcaaacatcaacgaccggagtttactg
gggaagcgggacagtgaactggctgtgctgatcgaggacacggagatggaggcatccctc
atgaatggtgtggaatatcaggcgggcaggtttgccttgagtttgcggaaacactgcttc
agcgtgattctcggggcagatgcccggccagacctggatctccgagaccctgtctgtgat
gactttttccagtcgtggcaagacacagctgagagcaatgccaatatctatgagcagatc
ttccgctgcctgccgtccaacgccactcgctccctgagggcactccgggagtatgtggcc
gtggagccgctggccacggtcagccctcccttggcccggtctgaactcacccaggtccag
ggccacctggtccacttccccctcaagttcctggaggatgagtctttgctgcccaccctg
ggtagcaaggagggcatgatacccctggaagtgtggacgtag

KEGG   Physeter catodon (sperm whale): 102986218
Entry
102986218         CDS       T06011                                 

Gene name
PLD1
Definition
(RefSeq) phospholipase D1 isoform X1
  KO
K01115  phospholipase D1/2 [EC:3.1.4.4]
Organism
pcad  Physeter catodon (sperm whale)
Pathway
pcad00564  Glycerophospholipid metabolism
pcad00565  Ether lipid metabolism
pcad01100  Metabolic pathways
pcad04014  Ras signaling pathway
pcad04024  cAMP signaling pathway
pcad04071  Sphingolipid signaling pathway
pcad04072  Phospholipase D signaling pathway
pcad04144  Endocytosis
pcad04666  Fc gamma R-mediated phagocytosis
pcad04724  Glutamatergic synapse
pcad04912  GnRH signaling pathway
pcad04928  Parathyroid hormone synthesis, secretion and action
pcad05200  Pathways in cancer
pcad05212  Pancreatic cancer
pcad05231  Choline metabolism in cancer
Brite
KEGG Orthology (KO) [BR:pcad00001]
 09100 Metabolism
  09103 Lipid metabolism
   00564 Glycerophospholipid metabolism
    102986218 (PLD1)
   00565 Ether lipid metabolism
    102986218 (PLD1)
 09130 Environmental Information Processing
  09132 Signal transduction
   04014 Ras signaling pathway
    102986218 (PLD1)
   04072 Phospholipase D signaling pathway
    102986218 (PLD1)
   04071 Sphingolipid signaling pathway
    102986218 (PLD1)
   04024 cAMP signaling pathway
    102986218 (PLD1)
 09140 Cellular Processes
  09141 Transport and catabolism
   04144 Endocytosis
    102986218 (PLD1)
 09150 Organismal Systems
  09151 Immune system
   04666 Fc gamma R-mediated phagocytosis
    102986218 (PLD1)
  09152 Endocrine system
   04912 GnRH signaling pathway
    102986218 (PLD1)
   04928 Parathyroid hormone synthesis, secretion and action
    102986218 (PLD1)
  09156 Nervous system
   04724 Glutamatergic synapse
    102986218 (PLD1)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    102986218 (PLD1)
   05231 Choline metabolism in cancer
    102986218 (PLD1)
  09162 Cancer: specific types
   05212 Pancreatic cancer
    102986218 (PLD1)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04131 Membrane trafficking [BR:pcad04131]
    102986218 (PLD1)
Enzymes [BR:pcad01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.4  Phosphoric-diester hydrolases
    3.1.4.4  phospholipase D
     102986218 (PLD1)
Membrane trafficking [BR:pcad04131]
 Exocytosis
  Calcium ion-dependent exocytosis
   Phospholipases
    102986218 (PLD1)
 Endosome - Golgi transport
  Others
   Others
    102986218 (PLD1)
SSDB
Motif
Pfam: PLDc_2 PX PLDc PH zf-C2HE
Other DBs
NCBI-GeneID: 102986218
NCBI-ProteinID: XP_023980106
UniProt: A0A2Y9SN90
LinkDB
Position
1
AA seq 1074 aa
MSLKDEPRVNTSALQKIAADMSNLIENLDTRELHFEGEEVDYDVSPSDPRIQEVYIPYSA
IYKTQGFKEPNTQTYLSGCPIKVQVLEVERLTSTKRVPSINLYTIELTHGEFKWQVKRKF
KHFQEFHRELLKYKAFIRIPIPTRRHTFRRQNVKEEPREMPSLPRSSENMIQEEQFFGRR
KQLEDYLTKLLKMPMYRNYHATTEFLDISQLSFIHDLGPKGIEGMIMKRSGGHRIPGLNC
CGQGRACYRWSKRWLIVKDSFLLYMKPDSGAIGFVLLVDKEFRVKVGKKETETKYGLRID
SLSRTLILKCNSYRHARWWGGAIEEFIHKHGPNFLKDHRFGSYAAIQENTLAKWYVNAKG
YFEDVANAMEEAKEEIFITDWWLSPEIFLKRPVVEGNRWRLDYILKRKAQQGVRIFIMLY
KEVELALVINSEYSKRTLVHLHPNIKVMRHPDHVSSSVYLWAHHEKLIIIDQSVAFVGGI
DLAYGRWDDNEHRLTDVGSVKRIIGGPSLCSLTAETTESMESLSLEDKNESNKNLPILKT
VADADSKLKGRGKPRKFSRFSLYRQLHRHHLRNTDSISSIDSASSDCNHCRSRQNLIHGL
KPHLKLFRSSSESEQGLTRPNADTGSIRSLQTGVGELHGETRFWHGKDYCNFVFKDWVQL
DKPFADFIDRYSTPRMPWHDIASAVHGKAARDVARHFIQRWNFTKIMKPKYRSLSYPFLL
PKSQTTAHELKHQMPGSVHANVQLLRSAADWSAGIKYHEESIHAAYVCVIENSKHYIYIE
NQFFISCADDKVVFNKVGDAIAQRILKAHRESQRYRVYVVLPLLPGFEGDISTGGGNALQ
AIMHFNYRTMCRGENSILGQLKAEIGNQWINYISFCGLRTHAELEGNLVTELVYVHSKLL
IADDNTVIIGSANINDRSMLGKRDSEMAVIVQDTETVPSVMDEKEYQAGHFALGLRLQCF
RVVLGYLSDPSEDIQDPVSDKFFKEVWVSTAARNATIYDKVFRCLPNDEVHNLTQLRDFI
SKPILAKEDPIRAEEELKKIRGFLVQFPFYFLSEENLLPSVGTKEAIVPTEVWT
NT seq 3225 nt   +upstreamnt  +downstreamnt
atgtcactgaaagatgagccaagagtaaatacctctgcactgcagaaaattgctgctgac
atgagtaatttgatagaaaatctggacacgcgggagctccactttgagggagaggaggtg
gactacgatgtgtctcccagcgatcccaggatacaggaagtgtatatcccttactctgct
atttataagactcaaggatttaaggagcctaatacacagacgtatctctccggctgtcca
ataaaagttcaagttctggaagtggagcgcttaacatctacaaaaagggtaccaagcatc
aatctttacactattgaattaacacatggggaatttaaatggcaagttaagaggaagttc
aagcacttccaagaatttcacagagagctgctcaagtacaaagcctttatccgaattccc
attcccaccagaagacacacatttagaagacagaatgtcaaagaagaacctcgagagatg
ccaagtttgccccgttcatctgaaaacatgatccaagaagaacagttctttggtagaagg
aaacaactagaggattacttgacaaaattactaaaaatgcccatgtatagaaactatcat
gcaacaacagaattccttgatataagccagctgtccttcatccatgatttgggaccaaag
ggcatagaaggtatgataatgaaaagatccggtggacacagaataccaggcttgaactgc
tgtggtcagggaagggcctgctaccggtggtccaaaaggtggttgatagtaaaagattcc
tttttactatatatgaaaccagacagtggtgctattggcttcgtcctgctggtagacaaa
gaattcagagttaaggtgggaaagaaggagacggagacaaaatatggactccgaattgat
agtctttcaaggacactgattttaaaatgcaacagctatagacatgctcggtggtgggga
ggggctatagaagaattcatccataaacatggccccaactttctcaaagatcatcgattt
gggtcttatgctgctatccaagagaacactttagctaaatggtatgttaatgccaaagga
tattttgaagatgtggcaaatgcaatggaagaggcaaaagaagagatttttatcacagat
tggtggttgagtccagaaatcttcctgaaacgtccggtggttgaaggaaatcgttggagg
ttggactacattcttaagcgaaaagcacaacagggggtgcggatcttcattatgctctac
aaagaggtggaacttgctcttgtaatcaatagtgaatacagcaagaggactttggtgcat
ctacaccccaacataaaggtgatgaggcacccagatcacgtgtcatccagcgtatatctg
tgggctcatcacgagaaactcatcatcatcgaccagtcggtggcctttgtgggtgggatt
gacctggcctatggaaggtgggatgacaatgaacacagactcacggacgtgggcagcgtg
aagcgcatcatcgggggaccttctctgtgttccctcacagctgaaacaacagagtctatg
gaatccttaagcctcgaagataaaaacgaatctaacaaaaatctgcctatcctgaagact
gttgctgatgcagattcaaaactgaaaggaagaggaaagcccagaaagttctccagattc
agcctctacaggcagctgcacagacaccacctacgcaacacagacagcatcagcagcatt
gacagtgcctccagtgactgtaatcactgtaggagtcgtcagaatttaatccatggttta
aagccccacttgaaactctttcgctcttccagtgagtctgagcaagggctcactagacct
aacgctgacacgggctccatccgaagtttacagactggtgtgggagagctacatggggaa
accagattctggcatggaaaggactactgcaattttgtcttcaaagattgggttcaactt
gataaaccttttgctgatttcattgacaggtactccaccccccggatgccatggcatgac
atcgcctctgcagtccacgggaaggcggctcgcgacgtggcccgtcacttcatccagcgc
tggaacttcacgaagattatgaaaccaaaatatcggtccctttcttatccttttttgctt
ccaaaatctcaaacaacagcccatgagttgaaacaccaaatgcccgggtctgtccatgct
aatgtacagttgctccgttctgctgctgattggtctgctggtataaagtaccatgaagag
tccatccatgctgcttacgtctgtgtgatagagaacagcaagcactatatctatatagaa
aaccagtttttcataagctgcgctgatgacaaagttgtgttcaacaaggttggcgatgcc
attgctcagaggatactgaaagctcacagggaaagccagagataccgggtttatgttgtg
ttaccacttctgccaggttttgaaggagacatttcaaccggtggaggaaatgctctacag
gcaataatgcacttcaactacagaaccatgtgcagaggagaaaattccatccttggacaa
ttaaaagcagagatcggcaatcagtggataaattacatatccttctgtggtcttagaaca
cacgcagagcttgaaggaaacctagtcactgagcttgtctatgtccacagcaagttgcta
attgctgatgacaacactgttattattggctctgccaacataaacgaccgaagcatgctg
ggaaaacgggacagtgaaatggctgtcattgtgcaggacacggagacggtcccttcagta
atggatgaaaaagagtaccaagctggccactttgccctaggacttcggctgcagtgcttt
cgggttgtcctcggctatctttctgaccctagtgaagacattcaggatccagtgagtgac
aaattcttcaaggaggtgtgggtttcaacggcagctcgaaatgctacaatttatgataag
gtgttccggtgccttcccaatgacgaagtacacaatttaactcagctgagagactttata
agcaagcccatcttagcaaaggaagatcccattagagctgaggaagaactgaaaaagatc
cgtgggttcttggtacaattccccttttatttcctgtctgaagaaaacctactgccttct
gttggaaccaaagaagccatagtgcccaccgaggtttggacttaa

DBGET integrated database retrieval system