KEGG   Physeter catodon (sperm whale): 102979009
Entry
102979009         CDS       T06011                                 

Gene name
FGF1
Definition
(RefSeq) fibroblast growth factor 1 isoform X1
  KO
K18496  fibroblast growth factor 1
Organism
pcad  Physeter catodon (sperm whale)
Pathway
pcad04010  MAPK signaling pathway
pcad04014  Ras signaling pathway
pcad04015  Rap1 signaling pathway
pcad04151  PI3K-Akt signaling pathway
pcad04390  Hippo signaling pathway
pcad04810  Regulation of actin cytoskeleton
pcad05200  Pathways in cancer
pcad05218  Melanoma
pcad05224  Breast cancer
pcad05226  Gastric cancer
Brite
KEGG Orthology (KO) [BR:pcad00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04010 MAPK signaling pathway
    102979009 (FGF1)
   04014 Ras signaling pathway
    102979009 (FGF1)
   04015 Rap1 signaling pathway
    102979009 (FGF1)
   04390 Hippo signaling pathway
    102979009 (FGF1)
   04151 PI3K-Akt signaling pathway
    102979009 (FGF1)
 09140 Cellular Processes
  09142 Cell motility
   04810 Regulation of actin cytoskeleton
    102979009 (FGF1)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    102979009 (FGF1)
  09162 Cancer: specific types
   05226 Gastric cancer
    102979009 (FGF1)
   05218 Melanoma
    102979009 (FGF1)
   05224 Breast cancer
    102979009 (FGF1)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04052 Cytokines and growth factors [BR:pcad04052]
    102979009 (FGF1)
   00536 Glycosaminoglycan binding proteins [BR:pcad00536]
    102979009 (FGF1)
Cytokines and growth factors [BR:pcad04052]
 Growth factors
  Growth factors (RTK binding)
   102979009 (FGF1)
Glycosaminoglycan binding proteins [BR:pcad00536]
 Heparan sulfate / Haparin
  Growth factors/receptors
   102979009 (FGF1)
SSDB
Motif
Pfam: FGF Fascin
Other DBs
NCBI-GeneID: 102979009
NCBI-ProteinID: XP_007123386
UniProt: A0A2Y9FHW3
LinkDB
Position
8
AA seq 154 aa
MAEGEITTFTALTEKFNLPPGNYKKPKLLYCSNGGHFLRILPDGTVDGTRDRSDQHIQLQ
LSAESVGEVYIKSTETGQYLAMDTDGLLYGSTPNEECLFLERLEENHYNTYTSKKHAEKN
WFVGLKKNGSCKRGPRTHYGQKAILFLPLPVSSD
NT seq 465 nt   +upstreamnt  +downstreamnt
atggctgaaggggaaatcacaaccttcacagccctgacggagaagtttaatctgcctcca
gggaattacaagaagcccaaactcctctactgtagcaacgggggccacttcctgaggatc
cttccagatggcacagtggatgggacaagggacaggagtgaccagcacattcagctgcag
ctcagtgcggaaagcgtgggggaggtgtatataaagagtacggagactggccagtacttg
gccatggacaccgacgggcttttgtacggctcaacacccaatgaggaatgtttgttcctg
gaaaggctggaggaaaaccattacaacacctacacatccaagaagcatgcagaaaagaat
tggttcgttggtctcaagaagaacggaagctgcaaacgcggtcctcggactcactatggc
cagaaagcaattttgtttcttcccctgccagtctcctctgattaa

DBGET integrated database retrieval system