KEGG   Physeter catodon (sperm whale): 102979041
Entry
102979041         CDS       T06011                                 

Gene name
RALB
Definition
(RefSeq) ras-related protein Ral-B
  KO
K07835  Ras-related protein Ral-B
Organism
pcad  Physeter catodon (sperm whale)
Pathway
pcad04014  Ras signaling pathway
pcad04015  Rap1 signaling pathway
pcad04072  Phospholipase D signaling pathway
pcad05200  Pathways in cancer
pcad05210  Colorectal cancer
pcad05212  Pancreatic cancer
Brite
KEGG Orthology (KO) [BR:pcad00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04014 Ras signaling pathway
    102979041 (RALB)
   04015 Rap1 signaling pathway
    102979041 (RALB)
   04072 Phospholipase D signaling pathway
    102979041 (RALB)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    102979041 (RALB)
  09162 Cancer: specific types
   05210 Colorectal cancer
    102979041 (RALB)
   05212 Pancreatic cancer
    102979041 (RALB)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04131 Membrane trafficking [BR:pcad04131]
    102979041 (RALB)
  09183 Protein families: signaling and cellular processes
   04031 GTP-binding proteins [BR:pcad04031]
    102979041 (RALB)
Membrane trafficking [BR:pcad04131]
 Exocytosis
  Tethering complex
   Exocyst complex assembly proteins
    102979041 (RALB)
GTP-binding proteins [BR:pcad04031]
 Small (monomeric) G-proteins
  Ras Family
   Ral
    102979041 (RALB)
SSDB
Motif
Pfam: Ras Roc Arf RsgA_GTPase SRPRB GTP_EFTU MMR_HSR1 AAA_25 AAA_24
Other DBs
NCBI-GeneID: 102979041
NCBI-ProteinID: XP_007127939
UniProt: A0A2Y9S6B2
LinkDB
Position
2
AA seq 206 aa
MAANKSKSQSSLALHKVIMVGSGGVGKSALTLQFMYDEFVEDYEPTKADSYRKKVVLDGE
EVQIDILDTAGQEDYAAIRDNYFRSGEGFLLVFSITEHESFTATAEFREQVLRVKAGEEK
VPLLLAGNKSDLQERRQVPLEEARAKAEEWGAQYVETSAKTRANVDKVFFDLMREIRAKK
MSENKDKNGKKSNKNKKSFKERCCLL
NT seq 621 nt   +upstreamnt  +downstreamnt
atggctgcaaacaagagcaagagccagagctccctggcccttcacaaggtgatcatggtc
ggcagcggaggggtgggcaagtcggccctgaccttgcagttcatgtacgatgagttcgtg
gaggactatgaacctaccaaggctgacagttacaggaagaaagtggtcctggatggggag
gaagtccagatagacatcctggacacggccggacaggaggactacgcggccattcgcgac
aactacttccggagcggggagggcttcctccttgtgttttccatcaccgagcatgagtca
ttcacagcaactgccgagttcagggaacaggtcctccgcgttaaggcgggagaagagaaa
gttccgctgctgcttgcggggaacaagtccgacctgcaggagcggaggcaggtgccgctg
gaggaggccagggccaaggccgaggagtggggcgcgcagtacgtggagacctcggccaag
acgcgggccaacgtggacaaggtgttctttgacctcatgagagagatcagagcaaagaag
atgtcagaaaacaaagacaagaacggcaagaaaagcaacaagaacaagaaaagttttaaa
gaaagatgttgcttactgtga

KEGG   Physeter catodon (sperm whale): 102987577
Entry
102987577         CDS       T06011                                 

Gene name
RALA
Definition
(RefSeq) ras-related protein Ral-A
  KO
K07834  Ras-related protein Ral-A
Organism
pcad  Physeter catodon (sperm whale)
Pathway
pcad04014  Ras signaling pathway
pcad04015  Rap1 signaling pathway
pcad04072  Phospholipase D signaling pathway
pcad05132  Salmonella infection
pcad05200  Pathways in cancer
pcad05210  Colorectal cancer
pcad05212  Pancreatic cancer
Brite
KEGG Orthology (KO) [BR:pcad00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04014 Ras signaling pathway
    102987577 (RALA)
   04015 Rap1 signaling pathway
    102987577 (RALA)
   04072 Phospholipase D signaling pathway
    102987577 (RALA)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    102987577 (RALA)
  09162 Cancer: specific types
   05210 Colorectal cancer
    102987577 (RALA)
   05212 Pancreatic cancer
    102987577 (RALA)
  09171 Infectious disease: bacterial
   05132 Salmonella infection
    102987577 (RALA)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04131 Membrane trafficking [BR:pcad04131]
    102987577 (RALA)
  09183 Protein families: signaling and cellular processes
   04031 GTP-binding proteins [BR:pcad04031]
    102987577 (RALA)
Membrane trafficking [BR:pcad04131]
 Exocytosis
  Tethering complex
   Exocyst complex assembly proteins
    102987577 (RALA)
GTP-binding proteins [BR:pcad04031]
 Small (monomeric) G-proteins
  Ras Family
   Ral
    102987577 (RALA)
SSDB
Motif
Pfam: Ras Roc Arf RsgA_GTPase GTP_EFTU MMR_HSR1 AAA_25 MMR_HSR1_Xtn ThiF ATP_bind_1
Other DBs
NCBI-GeneID: 102987577
NCBI-ProteinID: XP_023970870
UniProt: A0A2Y9RX33
LinkDB
Position
5
AA seq 206 aa
MAANKPKGQNSLALHKVIMVGSGGVGKSALTLQFMYDEFVEDYEPTKADSYRKKVVLDGE
EVQIDILDTAGQEDYAAIRDNYFRSGEGFLCVFSITEMESFAATADFREQILRVKEDENV
PFLLVGNKSDLEDKRQVSVEEAKTRADQWNVNYVETSAKTRANVDKVFFDLMREIRARKM
EDSKEKNGKKKRKSLAKRIRERCCIL
NT seq 621 nt   +upstreamnt  +downstreamnt
atggctgcaaataagccaaagggtcagaattctttggccttacacaaagtcatcatggta
ggcagtggtggtgtgggcaagtctgctctgaccctgcagttcatgtatgatgagtttgtg
gaggactatgaacctaccaaagccgacagctaccggaagaaggtggtgctggacggggag
gaagtgcagatcgacatcctggatacagccgggcaggaggactacgctgccattagggac
aactacttccggagtggcgagggctttctctgcgtcttctccattacggaaatggagtcc
ttcgcggccacagccgacttcagggagcagattttaagagtaaaagaagatgagaatgtt
ccatttctgctcgtgggaaacaaatcagatttggaagataaaaggcaggtttctgtagaa
gaggcaaaaaccagagctgatcagtggaatgttaactatgtggaaacatctgctaaaaca
cgagctaatgttgacaaggtattttttgatttaatgagggaaattcgagccagaaagatg
gaagacagcaaagaaaagaatgggaaaaagaagaggaaaagtttagccaagagaataaga
gaaagatgctgcattttataa

DBGET integrated database retrieval system