KEGG   Physeter catodon (sperm whale): 102979864
Entry
102979864         CDS       T06011                                 

Gene name
FASLG
Definition
(RefSeq) tumor necrosis factor ligand superfamily member 6
  KO
K04389  tumor necrosis factor ligand superfamily member 6
Organism
pcad  Physeter catodon (sperm whale)
Pathway
pcad01524  Platinum drug resistance
pcad04010  MAPK signaling pathway
pcad04014  Ras signaling pathway
pcad04060  Cytokine-cytokine receptor interaction
pcad04068  FoxO signaling pathway
pcad04151  PI3K-Akt signaling pathway
pcad04210  Apoptosis
pcad04217  Necroptosis
pcad04650  Natural killer cell mediated cytotoxicity
pcad04722  Neurotrophin signaling pathway
pcad04932  Non-alcoholic fatty liver disease
pcad04940  Type I diabetes mellitus
pcad05022  Pathways of neurodegeneration - multiple diseases
pcad05142  Chagas disease
pcad05143  African trypanosomiasis
pcad05160  Hepatitis C
pcad05161  Hepatitis B
pcad05162  Measles
pcad05163  Human cytomegalovirus infection
pcad05164  Influenza A
pcad05165  Human papillomavirus infection
pcad05168  Herpes simplex virus 1 infection
pcad05170  Human immunodeficiency virus 1 infection
pcad05200  Pathways in cancer
pcad05205  Proteoglycans in cancer
pcad05320  Autoimmune thyroid disease
pcad05330  Allograft rejection
pcad05332  Graft-versus-host disease
Brite
KEGG Orthology (KO) [BR:pcad00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04010 MAPK signaling pathway
    102979864 (FASLG)
   04014 Ras signaling pathway
    102979864 (FASLG)
   04068 FoxO signaling pathway
    102979864 (FASLG)
   04151 PI3K-Akt signaling pathway
    102979864 (FASLG)
  09133 Signaling molecules and interaction
   04060 Cytokine-cytokine receptor interaction
    102979864 (FASLG)
 09140 Cellular Processes
  09143 Cell growth and death
   04210 Apoptosis
    102979864 (FASLG)
   04217 Necroptosis
    102979864 (FASLG)
 09150 Organismal Systems
  09151 Immune system
   04650 Natural killer cell mediated cytotoxicity
    102979864 (FASLG)
  09156 Nervous system
   04722 Neurotrophin signaling pathway
    102979864 (FASLG)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    102979864 (FASLG)
   05205 Proteoglycans in cancer
    102979864 (FASLG)
  09163 Immune disease
   05320 Autoimmune thyroid disease
    102979864 (FASLG)
   05330 Allograft rejection
    102979864 (FASLG)
   05332 Graft-versus-host disease
    102979864 (FASLG)
  09164 Neurodegenerative disease
   05022 Pathways of neurodegeneration - multiple diseases
    102979864 (FASLG)
  09167 Endocrine and metabolic disease
   04940 Type I diabetes mellitus
    102979864 (FASLG)
   04932 Non-alcoholic fatty liver disease
    102979864 (FASLG)
  09172 Infectious disease: viral
   05170 Human immunodeficiency virus 1 infection
    102979864 (FASLG)
   05161 Hepatitis B
    102979864 (FASLG)
   05160 Hepatitis C
    102979864 (FASLG)
   05164 Influenza A
    102979864 (FASLG)
   05162 Measles
    102979864 (FASLG)
   05168 Herpes simplex virus 1 infection
    102979864 (FASLG)
   05163 Human cytomegalovirus infection
    102979864 (FASLG)
   05165 Human papillomavirus infection
    102979864 (FASLG)
  09174 Infectious disease: parasitic
   05142 Chagas disease
    102979864 (FASLG)
   05143 African trypanosomiasis
    102979864 (FASLG)
  09176 Drug resistance: antineoplastic
   01524 Platinum drug resistance
    102979864 (FASLG)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:pcad04147]
    102979864 (FASLG)
   04052 Cytokines and growth factors [BR:pcad04052]
    102979864 (FASLG)
   04090 CD molecules [BR:pcad04090]
    102979864 (FASLG)
Exosome [BR:pcad04147]
 Exosomal proteins
  Exosomal proteins of colorectal cancer cells
   102979864 (FASLG)
Cytokines and growth factors [BR:pcad04052]
 Cytokines
  Tumor necrosis fators
   102979864 (FASLG)
CD molecules [BR:pcad04090]
 Proteins
  102979864 (FASLG)
SSDB
Motif
Pfam: TNF RskA EMP24_GP25L Lectin_N
Other DBs
NCBI-GeneID: 102979864
NCBI-ProteinID: XP_007107294
UniProt: A0A2Y9ERD6
LinkDB
Position
4
AA seq 262 aa
MQQPLNYPYPQIFWVDSSASSPWASPGSVFPCPSSVPGRPGQRRPPPLPPPLKKRRDHNT
GLCLLVMFFMVLVALVGLGMGLFQLFHLQKELAELRESTSQRHTESSLEKQIGHPNPSSK
KTELRKAAHLTGKPNSRSIPLEWEDTYGIALVSGVKYKKGSLVINETGLYFVYSKVYFRG
QSCNNQPLNHKVYTRNFRYPQDLVLMEGKMMNYCTTGQMWARSSYLGAVFNLTNADHLYV
NVSELSLVNFEESKTFFGLYKL
NT seq 789 nt   +upstreamnt  +downstreamnt
atgcagcagcccttgaattacccatacccccagattttctgggtggacagcagtgccagc
tctccctgggcctctccagggtcagtcttcccctgtccgtcctctgtgccaggaaggccg
gggcaaaggaggccaccaccactaccaccacctctgaagaagaggagggaccacaacaca
ggcctgtgtctccttgtgatgtttttcatggttctggtggccctggttggattggggatg
ggactatttcagctcttccacctgcagaaggaactggccgaactcagagagtccaccagc
caaaggcatacagaatcatctttggagaagcaaataggtcaccccaatccatcctctaag
aaaacggagctgagaaaggcagcccatttaacaggcaagcccaactcaagatccatccct
ctggaatgggaagacacttatggaattgccctggtttctggggtgaagtataagaagggc
agccttgtgatcaatgaaactgggctgtattttgtgtattccaaagtgtacttccggggt
cagtcctgcaacaaccagcccctgaaccacaaggtctacacgaggaactttaggtacccc
caggacctggtgctcatggaggggaagatgatgaactactgcactactggccagatgtgg
gcccgcagcagctacctgggggctgtgttcaatctcaccaatgctgaccatttatatgtc
aatgtatctgagctctctctggtcaattttgaggaatctaagacattttttggcttatat
aagctctaa

DBGET integrated database retrieval system