KEGG   Physeter catodon (sperm whale): 102980125
Entry
102980125         CDS       T06011                                 

Gene name
MDM2
Definition
(RefSeq) E3 ubiquitin-protein ligase Mdm2
  KO
K06643  E3 ubiquitin-protein ligase Mdm2 [EC:2.3.2.27]
Organism
pcad  Physeter catodon (sperm whale)
Pathway
pcad01522  Endocrine resistance
pcad01524  Platinum drug resistance
pcad04068  FoxO signaling pathway
pcad04110  Cell cycle
pcad04115  p53 signaling pathway
pcad04120  Ubiquitin mediated proteolysis
pcad04144  Endocytosis
pcad04151  PI3K-Akt signaling pathway
pcad04218  Cellular senescence
pcad04625  C-type lectin receptor signaling pathway
pcad04919  Thyroid hormone signaling pathway
pcad05163  Human cytomegalovirus infection
pcad05165  Human papillomavirus infection
pcad05169  Epstein-Barr virus infection
pcad05200  Pathways in cancer
pcad05202  Transcriptional misregulation in cancer
pcad05203  Viral carcinogenesis
pcad05205  Proteoglycans in cancer
pcad05206  MicroRNAs in cancer
pcad05214  Glioma
pcad05215  Prostate cancer
pcad05218  Melanoma
pcad05219  Bladder cancer
pcad05220  Chronic myeloid leukemia
Brite
KEGG Orthology (KO) [BR:pcad00001]
 09120 Genetic Information Processing
  09123 Folding, sorting and degradation
   04120 Ubiquitin mediated proteolysis
    102980125 (MDM2)
 09130 Environmental Information Processing
  09132 Signal transduction
   04068 FoxO signaling pathway
    102980125 (MDM2)
   04151 PI3K-Akt signaling pathway
    102980125 (MDM2)
 09140 Cellular Processes
  09141 Transport and catabolism
   04144 Endocytosis
    102980125 (MDM2)
  09143 Cell growth and death
   04110 Cell cycle
    102980125 (MDM2)
   04115 p53 signaling pathway
    102980125 (MDM2)
   04218 Cellular senescence
    102980125 (MDM2)
 09150 Organismal Systems
  09151 Immune system
   04625 C-type lectin receptor signaling pathway
    102980125 (MDM2)
  09152 Endocrine system
   04919 Thyroid hormone signaling pathway
    102980125 (MDM2)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    102980125 (MDM2)
   05202 Transcriptional misregulation in cancer
    102980125 (MDM2)
   05206 MicroRNAs in cancer
    102980125 (MDM2)
   05205 Proteoglycans in cancer
    102980125 (MDM2)
   05203 Viral carcinogenesis
    102980125 (MDM2)
  09162 Cancer: specific types
   05214 Glioma
    102980125 (MDM2)
   05220 Chronic myeloid leukemia
    102980125 (MDM2)
   05218 Melanoma
    102980125 (MDM2)
   05219 Bladder cancer
    102980125 (MDM2)
   05215 Prostate cancer
    102980125 (MDM2)
  09172 Infectious disease: viral
   05163 Human cytomegalovirus infection
    102980125 (MDM2)
   05169 Epstein-Barr virus infection
    102980125 (MDM2)
   05165 Human papillomavirus infection
    102980125 (MDM2)
  09176 Drug resistance: antineoplastic
   01524 Platinum drug resistance
    102980125 (MDM2)
   01522 Endocrine resistance
    102980125 (MDM2)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04131 Membrane trafficking [BR:pcad04131]
    102980125 (MDM2)
   04121 Ubiquitin system [BR:pcad04121]
    102980125 (MDM2)
Enzymes [BR:pcad01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.2  Aminoacyltransferases
    2.3.2.27  RING-type E3 ubiquitin transferase
     102980125 (MDM2)
Membrane trafficking [BR:pcad04131]
 Endocytosis
  Clathrin-mediated endocytosis
   Ubiquitin E3 ligases
    102980125 (MDM2)
Ubiquitin system [BR:pcad04121]
 Ubiquitin ligases (E3)
  Single Ring-finger type E3
   MDM2/MDM4 proteins
    102980125 (MDM2)
SSDB
Motif
Pfam: zf-C3HC4_3 SWIB zf-RanBP zf-RING_2 zf-FPG_IleRS
Other DBs
NCBI-GeneID: 102980125
NCBI-ProteinID: XP_007122347
UniProt: A0A2Y9FGP2
LinkDB
Position
6
AA seq 491 aa
MCNTSMSVSTDGAVSTSQIPASEQETLVRPKPLLLKLLKSVGAQKDTYTMKEVIFYLGQY
IMTKRLYDEKQQHIVYCSNDLLGDLFGVPSFSVKEHRKIYTMIYRNLVIVNQQEPSDSGT
SVSENRCHLEGGSVQKDLVQELQEEKPSSSDLVSRPSTSSRRRAVSETEENSDELPGERQ
RKRHKSDNISLSFDESLALCVIREICCERSSSSESTGTPSNPDLDAGVSEHSGDWLDQDS
VSDQFSVEFEVESLDSEDYSLSEEGQELSDEDDEVYRVTVYQAGESDTDSFEEDPEISLA
DYWKCTSCSEMNPPLPPHCNRCWALRENWLPEDKGIDKGKMSEKAKLENSAQVEEGFDVP
DCKKSTVNDSKESCVEENDDKITQASLSQESEDYSQPSTSNSIIYSSQEDVKEFEREETQ
DKEESVESSFPLNAIEPCVICQGRPKNGCIVHGKTGHLMACFTCAKKLKKRNKPCPVCRQ
PIQMIVLTYFP
NT seq 1476 nt   +upstreamnt  +downstreamnt
atgtgcaataccagcatgtctgtgtctactgatggtgctgtaagcacctcacagattcca
gcttcggaacaagagaccctggttagaccaaagccattgcttttgaagttgttgaagtct
gttggtgcacagaaggacacctatactatgaaagaggttatattttatcttggccagtat
attatgactaaacgattatatgatgagaaacaacagcatattgtatattgttcaaatgat
cttctaggggatttgtttggagtgccaagcttctctgtgaaagagcacaggaaaatatat
acaatgatttatagaaacttggtgatagtcaatcagcaggaaccatcagattcaggcaca
tctgtgagtgaaaacaggtgtcaccttgaaggtgggagtgttcaaaaggaccttgtgcaa
gagctacaggaagagaaaccttcatcttcagatttggtttctagaccatctacctcatct
agaaggagagcagttagtgagacagaagaaaattcagatgaattacctggtgaacgacaa
agaaagcgccacaaatctgataatatttccctttcctttgatgaaagccttgctctctgt
gtaataagggagatatgttgtgaaagaagcagtagcagtgaatcgacagggactccatca
aatccggatcttgatgctggtgtaagtgaacattcaggtgattggttggatcaggattca
gtttcagatcaattcagtgtagaatttgaagttgagtctcttgattcagaagattatagc
cttagtgaagaaggacaagaactctcagatgaagatgatgaggtatatcgagttactgtg
tatcaggcaggggagagtgatacagattcatttgaagaagatcctgaaatttccttagct
gactattggaagtgtacttcatgcagtgaaatgaatcctccccttccgcctcattgcaac
agatgttgggcccttcgtgaaaattggcttcctgaagataaagggatagataaagggaaa
atgtctgagaaagccaaactagaaaactcagcacaagtagaagagggctttgatgtccct
gactgtaagaaatctacagtgaatgattccaaagaatcatgtgttgaggaaaatgatgat
aagatcacacaagcctccctatcccaagaaagtgaggactattctcagccatcaacttct
aatagtatcatttatagtagccaagaagatgtcaaagagtttgagagggaagaaacacaa
gacaaagaagaaagtgtggaatctagttttcctcttaatgccattgaaccttgtgtgatt
tgccaaggtcgacctaaaaatggttgcatcgtccatggcaaaacaggacatcttatggca
tgctttacatgtgcaaagaagctaaagaaaaggaataagccctgccccgtatgcagacaa
ccaattcaaatgattgtgctaacttatttcccctag

DBGET integrated database retrieval system