Physeter catodon (sperm whale): 102980439 Help Entry 102980439         CDS       T06011                                  Gene name BCL2L1 Definition (RefSeq) bcl-2-like protein 1 isoform X1   KO K04570   Bcl-2-like 1 (apoptosis regulator Bcl-X) Organism pcad  Physeter catodon (sperm whale) Pathway pcad01521   EGFR tyrosine kinase inhibitor resistance pcad01524   Platinum drug resistance pcad04014   Ras signaling pathway pcad04064   NF-kappa B signaling pathway pcad04115   p53 signaling pathway pcad04137   Mitophagy - animal pcad04140   Autophagy - animal pcad04151   PI3K-Akt signaling pathway pcad04210   Apoptosis pcad04215   Apoptosis - multiple species pcad04621   NOD-like receptor signaling pathway pcad04630   JAK-STAT signaling pathway pcad05012   Parkinson disease pcad05014   Amyotrophic lateral sclerosis pcad05022   Pathways of neurodegeneration - multiple diseases pcad05145   Toxoplasmosis pcad05162   Measles pcad05166   Human T-cell leukemia virus 1 infection pcad05168   Herpes simplex virus 1 infection pcad05170   Human immunodeficiency virus 1 infection pcad05200   Pathways in cancer pcad05202   Transcriptional misregulation in cancer pcad05212   Pancreatic cancer pcad05220   Chronic myeloid leukemia pcad05222   Small cell lung cancer pcad05225   Hepatocellular carcinoma Brite KEGG Orthology (KO) [BR:pcad00001]  09130 Environmental Information Processing   09132 Signal transduction    04014 Ras signaling pathway     102980439 (BCL2L1)    04630 JAK-STAT signaling pathway     102980439 (BCL2L1)    04064 NF-kappa B signaling pathway     102980439 (BCL2L1)    04151 PI3K-Akt signaling pathway     102980439 (BCL2L1)  09140 Cellular Processes   09141 Transport and catabolism    04140 Autophagy - animal     102980439 (BCL2L1)    04137 Mitophagy - animal     102980439 (BCL2L1)   09143 Cell growth and death    04210 Apoptosis     102980439 (BCL2L1)    04215 Apoptosis - multiple species     102980439 (BCL2L1)    04115 p53 signaling pathway     102980439 (BCL2L1)  09150 Organismal Systems   09151 Immune system    04621 NOD-like receptor signaling pathway     102980439 (BCL2L1)  09160 Human Diseases   09161 Cancer: overview    05200 Pathways in cancer     102980439 (BCL2L1)    05202 Transcriptional misregulation in cancer     102980439 (BCL2L1)   09162 Cancer: specific types    05212 Pancreatic cancer     102980439 (BCL2L1)    05225 Hepatocellular carcinoma     102980439 (BCL2L1)    05220 Chronic myeloid leukemia     102980439 (BCL2L1)    05222 Small cell lung cancer     102980439 (BCL2L1)   09164 Neurodegenerative disease    05012 Parkinson disease     102980439 (BCL2L1)    05014 Amyotrophic lateral sclerosis     102980439 (BCL2L1)    05022 Pathways of neurodegeneration - multiple diseases     102980439 (BCL2L1)   09172 Infectious disease: viral    05166 Human T-cell leukemia virus 1 infection     102980439 (BCL2L1)    05170 Human immunodeficiency virus 1 infection     102980439 (BCL2L1)    05162 Measles     102980439 (BCL2L1)    05168 Herpes simplex virus 1 infection     102980439 (BCL2L1)   09174 Infectious disease: parasitic    05145 Toxoplasmosis     102980439 (BCL2L1)   09176 Drug resistance: antineoplastic    01521 EGFR tyrosine kinase inhibitor resistance     102980439 (BCL2L1)    01524 Platinum drug resistance     102980439 (BCL2L1)  09180 Brite Hierarchies   09181 Protein families: metabolism    01009 Protein phosphatases and associated proteins [BR:pcad01009]     102980439 (BCL2L1)   09182 Protein families: genetic information processing    03036 Chromosome and associated proteins [BR:pcad03036]     102980439 (BCL2L1)   09183 Protein families: signaling and cellular processes    02000 Transporters [BR:pcad02000]     102980439 (BCL2L1) Protein phosphatases and associated proteins [BR:pcad01009]  Protein serine/threonine phosphatases   Phosphoprotein phosphatases (PPPs)    Protein phosphatase-1     PP1-interacting proteins (PIPs)      102980439 (BCL2L1) Chromosome and associated proteins [BR:pcad03036]  Eukaryotic type   Centrosome formation and ciliogenesis proteins    Other centriole associated proteins     102980439 (BCL2L1) Transporters [BR:pcad02000]  Other transporters   Pores ion channels [TC:1]    102980439 (BCL2L1) BRITE hierarchy SSDB OrthologParalogGFIT Motif Pfam:  Bcl-2 BH4 Bcl-2_3 Motif Other DBs NCBI-GeneID:  102980439 NCBI-ProteinID:  XP_007124312 UniProt:  A0A2Y9FIV6 LinkDB All DBs Position Unknown AA seq 233 aa AA seqDB search MSQSNRELVVDFLSYKLSQKGYSWSQFSDVDENRTEAPEGTESDMETPSAINGNPSWHLA DSPAVNGATGHSSSLDAREVIPMAAVKQALREAGDEFELRYRRAFSDLTSQLHITPGTAY QSFEQVVNELFRDGVNWGRIVAFFSFGGALCVESVDKEMQVLVSRIAAWMATYLNDHLEP WIQENGGWDTFVELYGNNAAAESRKGQERFNRWFLTGMTVAGVVLLGSLFSRK NT seq 702 nt NT seq  +upstreamnt  +downstreamnt atgtctcagagcaatcgggagctggtggttgactttctctcctacaagctttcccagaaa ggatacagctggagtcagtttagtgatgtggacgagaacagaactgaggccccagaaggg actgaatcagacatggaaacccccagtgccatcaatggcaacccgtcctggcacctggca gacagccctgcggtgaatggagccactggccacagcagcagcttggatgcccgggaggtg atccccatggcagcggtgaagcaagcgctgagggaggcaggcgatgagtttgaactgagg taccggcgggcattcagcgacctgacatcccagctccacatcaccccagggacggcatat cagagctttgagcaggtagtgaacgaactcttccgggatggggtgaactggggtcgcatt gtggcctttttctccttcggtggggcactgtgcgtggaaagcgtagacaaggagatgcag gtattggtgagtcggattgcagcttggatggccacttacctgaatgaccacctagagcct tggatccaggagaacggcggctgggacactttcgtggaactctacgggaacaatgcagca gccgagagccggaagggccaggagcgcttcaaccgctggttcctgacgggcatgactgtc gctggcgtggttctgctgggctcgctcttcagtcggaaatga

DBGET integrated database retrieval system