KEGG   Physeter catodon (sperm whale): 102980439
Entry
102980439         CDS       T06011                                 

Gene name
BCL2L1
Definition
(RefSeq) bcl-2-like protein 1 isoform X1
  KO
K04570  Bcl-2-like 1 (apoptosis regulator Bcl-X)
Organism
pcad  Physeter catodon (sperm whale)
Pathway
pcad01521  EGFR tyrosine kinase inhibitor resistance
pcad01524  Platinum drug resistance
pcad04014  Ras signaling pathway
pcad04064  NF-kappa B signaling pathway
pcad04115  p53 signaling pathway
pcad04137  Mitophagy - animal
pcad04140  Autophagy - animal
pcad04151  PI3K-Akt signaling pathway
pcad04210  Apoptosis
pcad04215  Apoptosis - multiple species
pcad04621  NOD-like receptor signaling pathway
pcad04630  JAK-STAT signaling pathway
pcad05012  Parkinson disease
pcad05014  Amyotrophic lateral sclerosis
pcad05022  Pathways of neurodegeneration - multiple diseases
pcad05145  Toxoplasmosis
pcad05162  Measles
pcad05166  Human T-cell leukemia virus 1 infection
pcad05168  Herpes simplex virus 1 infection
pcad05170  Human immunodeficiency virus 1 infection
pcad05200  Pathways in cancer
pcad05202  Transcriptional misregulation in cancer
pcad05212  Pancreatic cancer
pcad05220  Chronic myeloid leukemia
pcad05222  Small cell lung cancer
pcad05225  Hepatocellular carcinoma
Brite
KEGG Orthology (KO) [BR:pcad00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04014 Ras signaling pathway
    102980439 (BCL2L1)
   04630 JAK-STAT signaling pathway
    102980439 (BCL2L1)
   04064 NF-kappa B signaling pathway
    102980439 (BCL2L1)
   04151 PI3K-Akt signaling pathway
    102980439 (BCL2L1)
 09140 Cellular Processes
  09141 Transport and catabolism
   04140 Autophagy - animal
    102980439 (BCL2L1)
   04137 Mitophagy - animal
    102980439 (BCL2L1)
  09143 Cell growth and death
   04210 Apoptosis
    102980439 (BCL2L1)
   04215 Apoptosis - multiple species
    102980439 (BCL2L1)
   04115 p53 signaling pathway
    102980439 (BCL2L1)
 09150 Organismal Systems
  09151 Immune system
   04621 NOD-like receptor signaling pathway
    102980439 (BCL2L1)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    102980439 (BCL2L1)
   05202 Transcriptional misregulation in cancer
    102980439 (BCL2L1)
  09162 Cancer: specific types
   05212 Pancreatic cancer
    102980439 (BCL2L1)
   05225 Hepatocellular carcinoma
    102980439 (BCL2L1)
   05220 Chronic myeloid leukemia
    102980439 (BCL2L1)
   05222 Small cell lung cancer
    102980439 (BCL2L1)
  09164 Neurodegenerative disease
   05012 Parkinson disease
    102980439 (BCL2L1)
   05014 Amyotrophic lateral sclerosis
    102980439 (BCL2L1)
   05022 Pathways of neurodegeneration - multiple diseases
    102980439 (BCL2L1)
  09172 Infectious disease: viral
   05166 Human T-cell leukemia virus 1 infection
    102980439 (BCL2L1)
   05170 Human immunodeficiency virus 1 infection
    102980439 (BCL2L1)
   05162 Measles
    102980439 (BCL2L1)
   05168 Herpes simplex virus 1 infection
    102980439 (BCL2L1)
  09174 Infectious disease: parasitic
   05145 Toxoplasmosis
    102980439 (BCL2L1)
  09176 Drug resistance: antineoplastic
   01521 EGFR tyrosine kinase inhibitor resistance
    102980439 (BCL2L1)
   01524 Platinum drug resistance
    102980439 (BCL2L1)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01009 Protein phosphatases and associated proteins [BR:pcad01009]
    102980439 (BCL2L1)
  09182 Protein families: genetic information processing
   03036 Chromosome and associated proteins [BR:pcad03036]
    102980439 (BCL2L1)
  09183 Protein families: signaling and cellular processes
   02000 Transporters [BR:pcad02000]
    102980439 (BCL2L1)
Protein phosphatases and associated proteins [BR:pcad01009]
 Protein serine/threonine phosphatases
  Phosphoprotein phosphatases (PPPs)
   Protein phosphatase-1
    PP1-interacting proteins (PIPs)
     102980439 (BCL2L1)
Chromosome and associated proteins [BR:pcad03036]
 Eukaryotic type
  Centrosome formation and ciliogenesis proteins
   Other centriole associated proteins
    102980439 (BCL2L1)
Transporters [BR:pcad02000]
 Other transporters
  Pores ion channels [TC:1]
   102980439 (BCL2L1)
SSDB
Motif
Pfam: Bcl-2 BH4 Bcl-2_3
Other DBs
NCBI-GeneID: 102980439
NCBI-ProteinID: XP_007124312
UniProt: A0A2Y9FIV6
LinkDB
Position
Unknown
AA seq 233 aa
MSQSNRELVVDFLSYKLSQKGYSWSQFSDVDENRTEAPEGTESDMETPSAINGNPSWHLA
DSPAVNGATGHSSSLDAREVIPMAAVKQALREAGDEFELRYRRAFSDLTSQLHITPGTAY
QSFEQVVNELFRDGVNWGRIVAFFSFGGALCVESVDKEMQVLVSRIAAWMATYLNDHLEP
WIQENGGWDTFVELYGNNAAAESRKGQERFNRWFLTGMTVAGVVLLGSLFSRK
NT seq 702 nt   +upstreamnt  +downstreamnt
atgtctcagagcaatcgggagctggtggttgactttctctcctacaagctttcccagaaa
ggatacagctggagtcagtttagtgatgtggacgagaacagaactgaggccccagaaggg
actgaatcagacatggaaacccccagtgccatcaatggcaacccgtcctggcacctggca
gacagccctgcggtgaatggagccactggccacagcagcagcttggatgcccgggaggtg
atccccatggcagcggtgaagcaagcgctgagggaggcaggcgatgagtttgaactgagg
taccggcgggcattcagcgacctgacatcccagctccacatcaccccagggacggcatat
cagagctttgagcaggtagtgaacgaactcttccgggatggggtgaactggggtcgcatt
gtggcctttttctccttcggtggggcactgtgcgtggaaagcgtagacaaggagatgcag
gtattggtgagtcggattgcagcttggatggccacttacctgaatgaccacctagagcct
tggatccaggagaacggcggctgggacactttcgtggaactctacgggaacaatgcagca
gccgagagccggaagggccaggagcgcttcaaccgctggttcctgacgggcatgactgtc
gctggcgtggttctgctgggctcgctcttcagtcggaaatga

DBGET integrated database retrieval system