KEGG   Physeter catodon (sperm whale): 102980748
Entry
102980748         CDS       T06011                                 

Definition
(RefSeq) LOW QUALITY PROTEIN: whey acidic protein-like
  KO
K17106  whey acidic protein
Organism
pcad  Physeter catodon (sperm whale)
Pathway
pcad04917  Prolactin signaling pathway
Brite
KEGG Orthology (KO) [BR:pcad00001]
 09150 Organismal Systems
  09152 Endocrine system
   04917 Prolactin signaling pathway
    102980748
SSDB
Motif
Pfam: WAP Conotoxin_I2
Other DBs
NCBI-GeneID: 102980748
NCBI-ProteinID: XP_028346047
UniProt: A0A455BBA4
LinkDB
Position
5
AA seq 208 aa
MVHLIRNSFFVYKCGPRQQLPSLGSVQDGSPSVPLGQSQPPALPPCHAPPPAASFKGAPG
PPATTRCLASLALTLLALKAALTLAPALTLPGQAVCPELSSSSEDSGTISCVKDENCPQG
TKCCARSPCSRSCVVPLIVPVPKAGRCPXVQAPLAPKLCLERNECSRDDQCMENQKCCFS
SCAMRCTVPATGSTSSGASASPAEDSLQ
NT seq 627 nt   +upstreamnt  +downstreamnt
atggtccaccttattaggaattctttttttgtttacaaatgtggcccaaggcagcagctg
cccagtctggggtctgtccaagacggaagcccctcggtcccactggggcagagccagccg
cccgccctccctccctgccatgctcctccccccgctgcctcctttaaaggtgccccaggg
ccacccgccaccacgcgctgtcttgccagcctggccctgaccctgctcgccctgaaggct
gccctcacgctggccccggccctcaccttgccagggcaggctgtgtgcccagagctcagc
tcctcctccgaggattccggcacaatctcctgtgtcaaagatgagaactgtccccaaggc
accaagtgctgcgccaggagcccctgcagccgatcctgcgtggtccccctcatagtgcct
gttccaaaggctggccgctgtcccngggtgcaggccccgctggccccaaagctctgccta
gagagaaacgagtgctccagggatgaccaatgtatggagaaccagaagtgctgcttcagc
tcgtgtgctatgaggtgtacggtccccgccacaggctccacctcctctggggcctccgcg
tcccctgcagaggactctctccagtga

DBGET integrated database retrieval system