KEGG   Physeter catodon (sperm whale): 102980964
Entry
102980964         CDS       T06011                                 

Gene name
IKBKG
Definition
(RefSeq) NF-kappa-B essential modulator
  KO
K07210  inhibitor of nuclear factor kappa-B kinase subunit gamma
Organism
pcad  Physeter catodon (sperm whale)
Pathway
pcad01523  Antifolate resistance
pcad04010  MAPK signaling pathway
pcad04014  Ras signaling pathway
pcad04062  Chemokine signaling pathway
pcad04064  NF-kappa B signaling pathway
pcad04151  PI3K-Akt signaling pathway
pcad04210  Apoptosis
pcad04380  Osteoclast differentiation
pcad04620  Toll-like receptor signaling pathway
pcad04621  NOD-like receptor signaling pathway
pcad04622  RIG-I-like receptor signaling pathway
pcad04623  Cytosolic DNA-sensing pathway
pcad04625  C-type lectin receptor signaling pathway
pcad04657  IL-17 signaling pathway
pcad04658  Th1 and Th2 cell differentiation
pcad04659  Th17 cell differentiation
pcad04660  T cell receptor signaling pathway
pcad04662  B cell receptor signaling pathway
pcad04668  TNF signaling pathway
pcad04920  Adipocytokine signaling pathway
pcad05132  Salmonella infection
pcad05135  Yersinia infection
pcad05142  Chagas disease
pcad05145  Toxoplasmosis
pcad05160  Hepatitis C
pcad05161  Hepatitis B
pcad05162  Measles
pcad05163  Human cytomegalovirus infection
pcad05164  Influenza A
pcad05165  Human papillomavirus infection
pcad05166  Human T-cell leukemia virus 1 infection
pcad05167  Kaposi sarcoma-associated herpesvirus infection
pcad05168  Herpes simplex virus 1 infection
pcad05169  Epstein-Barr virus infection
pcad05170  Human immunodeficiency virus 1 infection
pcad05200  Pathways in cancer
pcad05203  Viral carcinogenesis
pcad05212  Pancreatic cancer
pcad05215  Prostate cancer
pcad05220  Chronic myeloid leukemia
pcad05221  Acute myeloid leukemia
pcad05222  Small cell lung cancer
pcad05235  PD-L1 expression and PD-1 checkpoint pathway in cancer
pcad05340  Primary immunodeficiency
pcad05418  Fluid shear stress and atherosclerosis
Brite
KEGG Orthology (KO) [BR:pcad00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04010 MAPK signaling pathway
    102980964 (IKBKG)
   04014 Ras signaling pathway
    102980964 (IKBKG)
   04064 NF-kappa B signaling pathway
    102980964 (IKBKG)
   04668 TNF signaling pathway
    102980964 (IKBKG)
   04151 PI3K-Akt signaling pathway
    102980964 (IKBKG)
 09140 Cellular Processes
  09143 Cell growth and death
   04210 Apoptosis
    102980964 (IKBKG)
 09150 Organismal Systems
  09151 Immune system
   04620 Toll-like receptor signaling pathway
    102980964 (IKBKG)
   04621 NOD-like receptor signaling pathway
    102980964 (IKBKG)
   04622 RIG-I-like receptor signaling pathway
    102980964 (IKBKG)
   04623 Cytosolic DNA-sensing pathway
    102980964 (IKBKG)
   04625 C-type lectin receptor signaling pathway
    102980964 (IKBKG)
   04660 T cell receptor signaling pathway
    102980964 (IKBKG)
   04658 Th1 and Th2 cell differentiation
    102980964 (IKBKG)
   04659 Th17 cell differentiation
    102980964 (IKBKG)
   04657 IL-17 signaling pathway
    102980964 (IKBKG)
   04662 B cell receptor signaling pathway
    102980964 (IKBKG)
   04062 Chemokine signaling pathway
    102980964 (IKBKG)
  09152 Endocrine system
   04920 Adipocytokine signaling pathway
    102980964 (IKBKG)
  09158 Development and regeneration
   04380 Osteoclast differentiation
    102980964 (IKBKG)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    102980964 (IKBKG)
   05203 Viral carcinogenesis
    102980964 (IKBKG)
   05235 PD-L1 expression and PD-1 checkpoint pathway in cancer
    102980964 (IKBKG)
  09162 Cancer: specific types
   05212 Pancreatic cancer
    102980964 (IKBKG)
   05221 Acute myeloid leukemia
    102980964 (IKBKG)
   05220 Chronic myeloid leukemia
    102980964 (IKBKG)
   05215 Prostate cancer
    102980964 (IKBKG)
   05222 Small cell lung cancer
    102980964 (IKBKG)
  09163 Immune disease
   05340 Primary immunodeficiency
    102980964 (IKBKG)
  09166 Cardiovascular disease
   05418 Fluid shear stress and atherosclerosis
    102980964 (IKBKG)
  09171 Infectious disease: bacterial
   05132 Salmonella infection
    102980964 (IKBKG)
   05135 Yersinia infection
    102980964 (IKBKG)
  09172 Infectious disease: viral
   05166 Human T-cell leukemia virus 1 infection
    102980964 (IKBKG)
   05170 Human immunodeficiency virus 1 infection
    102980964 (IKBKG)
   05162 Measles
    102980964 (IKBKG)
   05164 Influenza A
    102980964 (IKBKG)
   05161 Hepatitis B
    102980964 (IKBKG)
   05160 Hepatitis C
    102980964 (IKBKG)
   05168 Herpes simplex virus 1 infection
    102980964 (IKBKG)
   05163 Human cytomegalovirus infection
    102980964 (IKBKG)
   05167 Kaposi sarcoma-associated herpesvirus infection
    102980964 (IKBKG)
   05169 Epstein-Barr virus infection
    102980964 (IKBKG)
   05165 Human papillomavirus infection
    102980964 (IKBKG)
  09174 Infectious disease: parasitic
   05145 Toxoplasmosis
    102980964 (IKBKG)
   05142 Chagas disease
    102980964 (IKBKG)
  09176 Drug resistance: antineoplastic
   01523 Antifolate resistance
    102980964 (IKBKG)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01001 Protein kinases [BR:pcad01001]
    102980964 (IKBKG)
Protein kinases [BR:pcad01001]
 Serine/threonine kinases: Other
  IKK family [OT]
   102980964 (IKBKG)
SSDB
Motif
Pfam: CC2-LZ zf_C2H2_10 zf_C2H2_ZHX Exonuc_VII_L WXG100 SAM_Exu
Other DBs
NCBI-GeneID: 102980964
NCBI-ProteinID: XP_028338150
UniProt: A0A455ANA1
LinkDB
Position
21
AA seq 270 aa
LVPASARHGGDAGSTGGSCCGPSVTPHALARARAASEQARQLENEREALQQQHSVQVDQL
RLQNQSMDAALRMERQAASEEKRKLAQLQVAYHQLFQEYDNHIKSSVGLQLEELKQQLKQ
AEEALVAKQELIDKLKEEAEQHRVVMETVPVLKAQADIYKADFQAERQARERLAEKKELL
QEQLQQLRRGYSRLRGGCQDSARIEDMRKRHVEVSQPPLAPGPAHHSFHLALPSQRRSPP
EEPPNFCCPKCQYQAPDMDTLQIHVMECIE
NT seq 813 nt   +upstreamnt  +downstreamnt
cttgtccctgcctctgcgcggcatggcggggatgccgggagcacaggagggtcctgctgt
gggccctccgtgaccccccatgccctcgccagggcgcgggccgccagcgagcaggcccgg
cagctggagaacgagcgcgaggcgctgcagcagcagcacagcgtgcaggtggaccagctg
cgcctgcagaaccagagcatggacgctgccctgcgcatggagcgccaggctgcctcggag
gagaagaggaagctggcccagctgcaggtggcctatcaccagctcttccaagagtatgac
aaccacatcaagagcagcgtgggattgcagctggaagagctcaagcagcagctcaagcag
gccgaggaggccctggtggccaaacaggagctgatcgacaaactgaaggaagaggctgaa
cagcacagggtggtgatggagacggtcccggtgctgaaagcccaggcggatatctacaag
gcagatttccaggctgagaggcaggcccgggagaggctggccgagaagaaggagctcctg
caggagcagctgcagcagctgcggaggggctacagcaggctgaggggcggctgccaggac
tcggccaggatcgaagacatgaggaagcggcatgtagaggtctcccagccccccttagcc
ccgggcccagctcatcactcctttcacctggccctgcccagccagaggagaagcccccct
gaggagccgcccaacttctgctgccccaagtgccagtatcaggctcctgacatggacacc
ctgcagatacacgtcatggagtgcatcgagtag

DBGET integrated database retrieval system