KEGG   Physeter catodon (sperm whale): 102980970
Entry
102980970         CDS       T06011                                 

Gene name
FOXO3
Definition
(RefSeq) forkhead box protein O3 isoform X2
  KO
K09408  forkhead box protein O3
Organism
pcad  Physeter catodon (sperm whale)
Pathway
pcad01521  EGFR tyrosine kinase inhibitor resistance
pcad04062  Chemokine signaling pathway
pcad04068  FoxO signaling pathway
pcad04137  Mitophagy - animal
pcad04151  PI3K-Akt signaling pathway
pcad04152  AMPK signaling pathway
pcad04211  Longevity regulating pathway
pcad04213  Longevity regulating pathway - multiple species
pcad04218  Cellular senescence
pcad04722  Neurotrophin signaling pathway
pcad04917  Prolactin signaling pathway
pcad05213  Endometrial cancer
pcad05223  Non-small cell lung cancer
Brite
KEGG Orthology (KO) [BR:pcad00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04068 FoxO signaling pathway
    102980970 (FOXO3)
   04151 PI3K-Akt signaling pathway
    102980970 (FOXO3)
   04152 AMPK signaling pathway
    102980970 (FOXO3)
 09140 Cellular Processes
  09141 Transport and catabolism
   04137 Mitophagy - animal
    102980970 (FOXO3)
  09143 Cell growth and death
   04218 Cellular senescence
    102980970 (FOXO3)
 09150 Organismal Systems
  09151 Immune system
   04062 Chemokine signaling pathway
    102980970 (FOXO3)
  09152 Endocrine system
   04917 Prolactin signaling pathway
    102980970 (FOXO3)
  09156 Nervous system
   04722 Neurotrophin signaling pathway
    102980970 (FOXO3)
  09149 Aging
   04211 Longevity regulating pathway
    102980970 (FOXO3)
   04213 Longevity regulating pathway - multiple species
    102980970 (FOXO3)
 09160 Human Diseases
  09162 Cancer: specific types
   05213 Endometrial cancer
    102980970 (FOXO3)
   05223 Non-small cell lung cancer
    102980970 (FOXO3)
  09176 Drug resistance: antineoplastic
   01521 EGFR tyrosine kinase inhibitor resistance
    102980970 (FOXO3)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03000 Transcription factors [BR:pcad03000]
    102980970 (FOXO3)
Transcription factors [BR:pcad03000]
 Eukaryotic type
  Helix-turn-helix
   Fork head/winged helix other regulators
    102980970 (FOXO3)
SSDB
Motif
Pfam: FOXO_KIX_bdg Forkhead FOXO-TAD
Other DBs
NCBI-GeneID: 102980970
NCBI-ProteinID: XP_007100603
UniProt: A0A2Y9EEX1
LinkDB
Position
10
AA seq 672 aa
MAEAPASPAPLSPLEVELDPEFEPQSRPRSCTWPLQRPELQGSPAKPSGEAAADSMIPEE
EDDEDDEDGGGRADSAMAIGGCAGGPLGSGLLLEDSARLLAPGGQDPGSGPAPAAGALSG
GTQTPLQPQQTLPPPQPGAAGGSGQPRKCSSRRNAWGNLSYADLITRAIESSPDKRLTLS
QIYEWMVRCVPYFKDKGDSNSSAGWKNSIRHNLSLHSRFMRVQNEGTGKSSWWIINPDGG
KSGKAPRRRAVSMDNSNKYTKSRGRAAKKKAALQTATESADDSPSQLSKWPGSPTSRSSD
ELDAWTDFRSRTNSNASTVSGRLSPILASTELDDVQDDDAPLSPMLYSSSASLSPSVSKP
CTVELPRLTDMAGTMNLNDGLADNLMDDLLDNIALPASQPSPPGGLMQRSSSFPYTTKGS
GLGSPTSSFSSTVFGPSSLNSLRQSPMQTIQENKPATFSSMSHYGNQTLQDLLTSDSLSH
SDVMMTQSDPLMSQASTAVSAQNSRRNVMLRSDPMMSFAAQPNQGSLVNQNLLHHQHQTQ
GALGGSRALSSSVSNMGLSDSSNLGSAKHQQQSPVSQSMQTLSDSLSGSSLYSASAHLPV
MGHEKFPSDLDLDMFNGSLECDMESIIRSELMDADGLDFNFDSLISTQNVVGLNVGSFTG
AKQASSQSWVPG
NT seq 2019 nt   +upstreamnt  +downstreamnt
atggcagaggcgccggcctccccggccccgctctctccgctcgaagtggagctggacccg
gagttcgagccccaaagccggccgcgctcctgtacgtggcccctgcagaggccggagctc
caggggagcccggccaagccctcgggggaggcggccgctgactccatgatccccgaggag
gaggacgatgaagacgacgaggacggcggcggtagggccgactcggccatggcgatcggc
ggctgcgcgggcggcccgctgggctctgggctgctcctggaggactcggctcggctgcta
gctccgggagggcaggaccccgggtccgggccagcccccgcggcgggcgcgctgagcggg
gggacgcagacgccgctgcagcctcagcagacactgccaccgccgcagccgggggcggct
gggggctccgggcagccgaggaaatgctcgtcgcggcggaacgcctgggggaacctgtca
tacgccgacctgatcactcgcgccatcgagagctccccggacaaacggctcactctgtcc
cagatctacgagtggatggtgcgctgcgtgccctacttcaaggataagggcgacagcaac
agttctgcgggctggaagaactccatccggcacaacctgtcgctgcacagccggttcatg
cgggttcagaatgaggggaccggcaagagctcatggtggatcatcaaccccgacggggga
aagagtgggaaggcgccccggcggcgggccgtctccatggacaacagcaacaagtacacc
aagagccggggccgtgcagccaagaagaaggcagccctgcagaccgccaccgagtcagca
gacgacagtccctcccagctctccaagtggcccggcagccccacgtctcgcagcagtgat
gagctggatgcgtggaccgacttccgctcacgtaccaattccaatgccagcacagtcagc
ggccgcctgtcccccatcctggctagcacggagttggacgacgttcaggatgatgacgcg
ccactctcccccatgctctacagcagctcggccagcctgtccccctccgtcagcaagccg
tgcaccgtggagctgccccgcctgaccgacatggcgggcaccatgaatctgaacgatggg
ctggccgacaacctcatggacgacctgctggacaacatcgcgctccctgcgtcccagccg
tcgccccccgggggcctcatgcagcgcagctccagcttcccatacaccaccaagggctcc
ggcctgggctcccccaccagctccttcagcagcacggtgtttggcccctcgtctctgaac
tccctgcgtcagtctcccatgcagaccatccaagagaacaagccagccaccttctcttcc
atgtcgcactacggcaaccagacactccaggacctgctcacgtcggactcactcagccac
agcgatgtcatgatgacccagtcggaccccttgatgtctcaggccagcaccgctgtgtcc
gcccagaactcccgccggaacgtgatgcttcgcagtgatccaatgatgtcctttgccgcc
cagcctaaccaggggagtctggtcaatcagaacttgctccaccaccagcaccaaacccag
ggtgctctcggtggcagccgtgccttgtcaagttccgtcagcaacatgggcttgagcgat
tccagcaacctcgggtcagccaaacaccagcagcagtctcctgtcagccagtctatgcaa
accctctcggactctctctcaggctcctccttgtactcagctagtgcacaccttcccgtc
atgggccatgagaagttccccagcgacttggacctggacatgttcaatgggagcttggaa
tgtgacatggagtccattatccgtagcgaactcatggatgctgatgggttggattttaac
tttgattccctcatctccacacagaacgttgttggtttgaatgtggggagcttcactggt
gctaagcaggcctcatctcagagctgggtgccaggctga

DBGET integrated database retrieval system