KEGG   Physeter catodon (sperm whale): 102981091
Entry
102981091         CDS       T06011                                 

Gene name
PRKACB
Definition
(RefSeq) cAMP-dependent protein kinase catalytic subunit beta isoform X1
  KO
K04345  protein kinase A [EC:2.7.11.11]
Organism
pcad  Physeter catodon (sperm whale)
Pathway
pcad01522  Endocrine resistance
pcad04010  MAPK signaling pathway
pcad04014  Ras signaling pathway
pcad04020  Calcium signaling pathway
pcad04024  cAMP signaling pathway
pcad04062  Chemokine signaling pathway
pcad04114  Oocyte meiosis
pcad04140  Autophagy - animal
pcad04211  Longevity regulating pathway
pcad04213  Longevity regulating pathway - multiple species
pcad04261  Adrenergic signaling in cardiomyocytes
pcad04270  Vascular smooth muscle contraction
pcad04310  Wnt signaling pathway
pcad04340  Hedgehog signaling pathway
pcad04371  Apelin signaling pathway
pcad04530  Tight junction
pcad04540  Gap junction
pcad04611  Platelet activation
pcad04713  Circadian entrainment
pcad04714  Thermogenesis
pcad04720  Long-term potentiation
pcad04723  Retrograde endocannabinoid signaling
pcad04724  Glutamatergic synapse
pcad04725  Cholinergic synapse
pcad04726  Serotonergic synapse
pcad04727  GABAergic synapse
pcad04728  Dopaminergic synapse
pcad04740  Olfactory transduction
pcad04742  Taste transduction
pcad04750  Inflammatory mediator regulation of TRP channels
pcad04910  Insulin signaling pathway
pcad04911  Insulin secretion
pcad04912  GnRH signaling pathway
pcad04913  Ovarian steroidogenesis
pcad04914  Progesterone-mediated oocyte maturation
pcad04915  Estrogen signaling pathway
pcad04916  Melanogenesis
pcad04918  Thyroid hormone synthesis
pcad04919  Thyroid hormone signaling pathway
pcad04921  Oxytocin signaling pathway
pcad04922  Glucagon signaling pathway
pcad04923  Regulation of lipolysis in adipocytes
pcad04924  Renin secretion
pcad04925  Aldosterone synthesis and secretion
pcad04926  Relaxin signaling pathway
pcad04927  Cortisol synthesis and secretion
pcad04928  Parathyroid hormone synthesis, secretion and action
pcad04934  Cushing syndrome
pcad04935  Growth hormone synthesis, secretion and action
pcad04961  Endocrine and other factor-regulated calcium reabsorption
pcad04962  Vasopressin-regulated water reabsorption
pcad04970  Salivary secretion
pcad04971  Gastric acid secretion
pcad04976  Bile secretion
pcad05012  Parkinson disease
pcad05020  Prion disease
pcad05030  Cocaine addiction
pcad05031  Amphetamine addiction
pcad05032  Morphine addiction
pcad05034  Alcoholism
pcad05146  Amoebiasis
pcad05163  Human cytomegalovirus infection
pcad05165  Human papillomavirus infection
pcad05166  Human T-cell leukemia virus 1 infection
pcad05200  Pathways in cancer
pcad05203  Viral carcinogenesis
pcad05205  Proteoglycans in cancer
pcad05414  Dilated cardiomyopathy
Brite
KEGG Orthology (KO) [BR:pcad00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04010 MAPK signaling pathway
    102981091 (PRKACB)
   04014 Ras signaling pathway
    102981091 (PRKACB)
   04310 Wnt signaling pathway
    102981091 (PRKACB)
   04340 Hedgehog signaling pathway
    102981091 (PRKACB)
   04371 Apelin signaling pathway
    102981091 (PRKACB)
   04020 Calcium signaling pathway
    102981091 (PRKACB)
   04024 cAMP signaling pathway
    102981091 (PRKACB)
 09140 Cellular Processes
  09141 Transport and catabolism
   04140 Autophagy - animal
    102981091 (PRKACB)
  09143 Cell growth and death
   04114 Oocyte meiosis
    102981091 (PRKACB)
  09144 Cellular community - eukaryotes
   04530 Tight junction
    102981091 (PRKACB)
   04540 Gap junction
    102981091 (PRKACB)
 09150 Organismal Systems
  09151 Immune system
   04611 Platelet activation
    102981091 (PRKACB)
   04062 Chemokine signaling pathway
    102981091 (PRKACB)
  09152 Endocrine system
   04911 Insulin secretion
    102981091 (PRKACB)
   04910 Insulin signaling pathway
    102981091 (PRKACB)
   04922 Glucagon signaling pathway
    102981091 (PRKACB)
   04923 Regulation of lipolysis in adipocytes
    102981091 (PRKACB)
   04912 GnRH signaling pathway
    102981091 (PRKACB)
   04913 Ovarian steroidogenesis
    102981091 (PRKACB)
   04915 Estrogen signaling pathway
    102981091 (PRKACB)
   04914 Progesterone-mediated oocyte maturation
    102981091 (PRKACB)
   04921 Oxytocin signaling pathway
    102981091 (PRKACB)
   04926 Relaxin signaling pathway
    102981091 (PRKACB)
   04935 Growth hormone synthesis, secretion and action
    102981091 (PRKACB)
   04918 Thyroid hormone synthesis
    102981091 (PRKACB)
   04919 Thyroid hormone signaling pathway
    102981091 (PRKACB)
   04928 Parathyroid hormone synthesis, secretion and action
    102981091 (PRKACB)
   04916 Melanogenesis
    102981091 (PRKACB)
   04924 Renin secretion
    102981091 (PRKACB)
   04925 Aldosterone synthesis and secretion
    102981091 (PRKACB)
   04927 Cortisol synthesis and secretion
    102981091 (PRKACB)
  09153 Circulatory system
   04261 Adrenergic signaling in cardiomyocytes
    102981091 (PRKACB)
   04270 Vascular smooth muscle contraction
    102981091 (PRKACB)
  09154 Digestive system
   04970 Salivary secretion
    102981091 (PRKACB)
   04971 Gastric acid secretion
    102981091 (PRKACB)
   04976 Bile secretion
    102981091 (PRKACB)
  09155 Excretory system
   04962 Vasopressin-regulated water reabsorption
    102981091 (PRKACB)
   04961 Endocrine and other factor-regulated calcium reabsorption
    102981091 (PRKACB)
  09156 Nervous system
   04724 Glutamatergic synapse
    102981091 (PRKACB)
   04727 GABAergic synapse
    102981091 (PRKACB)
   04725 Cholinergic synapse
    102981091 (PRKACB)
   04728 Dopaminergic synapse
    102981091 (PRKACB)
   04726 Serotonergic synapse
    102981091 (PRKACB)
   04720 Long-term potentiation
    102981091 (PRKACB)
   04723 Retrograde endocannabinoid signaling
    102981091 (PRKACB)
  09157 Sensory system
   04740 Olfactory transduction
    102981091 (PRKACB)
   04742 Taste transduction
    102981091 (PRKACB)
   04750 Inflammatory mediator regulation of TRP channels
    102981091 (PRKACB)
  09149 Aging
   04211 Longevity regulating pathway
    102981091 (PRKACB)
   04213 Longevity regulating pathway - multiple species
    102981091 (PRKACB)
  09159 Environmental adaptation
   04713 Circadian entrainment
    102981091 (PRKACB)
   04714 Thermogenesis
    102981091 (PRKACB)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    102981091 (PRKACB)
   05205 Proteoglycans in cancer
    102981091 (PRKACB)
   05203 Viral carcinogenesis
    102981091 (PRKACB)
  09164 Neurodegenerative disease
   05012 Parkinson disease
    102981091 (PRKACB)
   05020 Prion disease
    102981091 (PRKACB)
  09165 Substance dependence
   05030 Cocaine addiction
    102981091 (PRKACB)
   05031 Amphetamine addiction
    102981091 (PRKACB)
   05032 Morphine addiction
    102981091 (PRKACB)
   05034 Alcoholism
    102981091 (PRKACB)
  09166 Cardiovascular disease
   05414 Dilated cardiomyopathy
    102981091 (PRKACB)
  09167 Endocrine and metabolic disease
   04934 Cushing syndrome
    102981091 (PRKACB)
  09172 Infectious disease: viral
   05166 Human T-cell leukemia virus 1 infection
    102981091 (PRKACB)
   05163 Human cytomegalovirus infection
    102981091 (PRKACB)
   05165 Human papillomavirus infection
    102981091 (PRKACB)
  09174 Infectious disease: parasitic
   05146 Amoebiasis
    102981091 (PRKACB)
  09176 Drug resistance: antineoplastic
   01522 Endocrine resistance
    102981091 (PRKACB)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01001 Protein kinases [BR:pcad01001]
    102981091 (PRKACB)
  09182 Protein families: genetic information processing
   03019 Messenger RNA biogenesis [BR:pcad03019]
    102981091 (PRKACB)
   03036 Chromosome and associated proteins [BR:pcad03036]
    102981091 (PRKACB)
Enzymes [BR:pcad01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.11  Protein-serine/threonine kinases
    2.7.11.11  cAMP-dependent protein kinase
     102981091 (PRKACB)
Protein kinases [BR:pcad01001]
 Serine/threonine kinases: AGC group
  PKA family
   102981091 (PRKACB)
Messenger RNA biogenesis [BR:pcad03019]
 Eukaryotic type
  mRNA surveillance and transport factors
   mRNA cycle factors
    Common to processing body (P body) and stress granule
     102981091 (PRKACB)
Chromosome and associated proteins [BR:pcad03036]
 Eukaryotic type
  Centrosome formation and ciliogenesis proteins
   Kinases and associated factors
    102981091 (PRKACB)
SSDB
Motif
Pfam: Pkinase PK_Tyr_Ser-Thr Kinase-like
Other DBs
NCBI-GeneID: 102981091
NCBI-ProteinID: XP_007106229
UniProt: A0A2Y9ENR4
LinkDB
Position
4
AA seq 351 aa
MGNAATAKKGSEVESVKEFLAKAKEDFLKKWENPAPNNAGLEDFERKKTLGTGSFGRVML
VKHKATEQYYAMKILDKQKVVKLKQIEHTLNEKRILQAVNFPFLVRLEYAFKDNSNLYMV
MEYVPGGEMFSHLRRIGRFSEPHARFYAAQIVLTFEYLHSLDLIYRDLKPENLLIDHQGY
IQVTDFGFAKRVKGRTWTLCGTPEYLAPEIILSKGYNKAVDWWALGVLIYEMAAGYPPFF
ADQPIQIYEKIVSGKVRFPSHFSSDLKDLLRNLLQVDLTKRFGNLKNGVSDIKTHKWFAT
TDWIAIYQRKVEAPFIPKFRGSGDTSNFDDYEEEDIRVSITEKCGKEFCEF
NT seq 1056 nt   +upstreamnt  +downstreamnt
atggggaacgcggcgaccgccaagaaaggaagcgaggtggagagcgtgaaagagtttcta
gccaaagccaaagaagactttttaaaaaaatgggaaaatcctgctccgaataatgccggg
ctggaagattttgaaaggaaaaaaacccttggaacaggttcatttggaagagtcatgttg
gtgaaacataaagccactgaacagtattatgcaatgaagatcttagataagcagaaggtt
gttaaactgaagcaaatagagcatactttgaatgagaaaagaatattacaggcagtgaat
tttccttttcttgttcgactggagtatgcttttaaggataattctaatttatacatggtt
atggaatatgtccctggtggtgaaatgttttcacatctaaggagaattggaaggttcagt
gaaccccatgcacggttctatgcagctcagatagtgctaacattcgagtacctccattca
ctagacctcatctacagagatctaaaacctgaaaatctcttaattgaccaccaaggttat
atccaggtcacagactttgggtttgccaaaagagttaaaggcagaacttggacattatgt
ggcactccagaatatttggctccagaaataattctcagcaagggctacaataaggcagtg
gattggtgggcattaggagtgttaatctatgaaatggcagctggctaccccccattcttt
gcagaccaaccaattcagatttatgaaaagattgtttccggaaaggttcgattcccttct
cacttcagttcagatctcaaggaccttctaaggaacctgctacaggtggacctgacgaag
cggtttggaaatctaaagaatggtgtgagtgatataaaaactcacaagtggtttgccaca
actgattggattgctatttaccagaggaaggttgaagctccattcataccaaagttcaga
ggctctggagataccagcaattttgatgactatgaagaagaagatatccgtgtctctata
acagaaaaatgtggaaaagaattttgtgaattttag

KEGG   Physeter catodon (sperm whale): 102995361
Entry
102995361         CDS       T06011                                 

Gene name
PRKACA
Definition
(RefSeq) cAMP-dependent protein kinase catalytic subunit alpha isoform X1
  KO
K04345  protein kinase A [EC:2.7.11.11]
Organism
pcad  Physeter catodon (sperm whale)
Pathway
pcad01522  Endocrine resistance
pcad04010  MAPK signaling pathway
pcad04014  Ras signaling pathway
pcad04020  Calcium signaling pathway
pcad04024  cAMP signaling pathway
pcad04062  Chemokine signaling pathway
pcad04114  Oocyte meiosis
pcad04140  Autophagy - animal
pcad04211  Longevity regulating pathway
pcad04213  Longevity regulating pathway - multiple species
pcad04261  Adrenergic signaling in cardiomyocytes
pcad04270  Vascular smooth muscle contraction
pcad04310  Wnt signaling pathway
pcad04340  Hedgehog signaling pathway
pcad04371  Apelin signaling pathway
pcad04530  Tight junction
pcad04540  Gap junction
pcad04611  Platelet activation
pcad04713  Circadian entrainment
pcad04714  Thermogenesis
pcad04720  Long-term potentiation
pcad04723  Retrograde endocannabinoid signaling
pcad04724  Glutamatergic synapse
pcad04725  Cholinergic synapse
pcad04726  Serotonergic synapse
pcad04727  GABAergic synapse
pcad04728  Dopaminergic synapse
pcad04740  Olfactory transduction
pcad04742  Taste transduction
pcad04750  Inflammatory mediator regulation of TRP channels
pcad04910  Insulin signaling pathway
pcad04911  Insulin secretion
pcad04912  GnRH signaling pathway
pcad04913  Ovarian steroidogenesis
pcad04914  Progesterone-mediated oocyte maturation
pcad04915  Estrogen signaling pathway
pcad04916  Melanogenesis
pcad04918  Thyroid hormone synthesis
pcad04919  Thyroid hormone signaling pathway
pcad04921  Oxytocin signaling pathway
pcad04922  Glucagon signaling pathway
pcad04923  Regulation of lipolysis in adipocytes
pcad04924  Renin secretion
pcad04925  Aldosterone synthesis and secretion
pcad04926  Relaxin signaling pathway
pcad04927  Cortisol synthesis and secretion
pcad04928  Parathyroid hormone synthesis, secretion and action
pcad04934  Cushing syndrome
pcad04935  Growth hormone synthesis, secretion and action
pcad04961  Endocrine and other factor-regulated calcium reabsorption
pcad04962  Vasopressin-regulated water reabsorption
pcad04970  Salivary secretion
pcad04971  Gastric acid secretion
pcad04976  Bile secretion
pcad05012  Parkinson disease
pcad05020  Prion disease
pcad05030  Cocaine addiction
pcad05031  Amphetamine addiction
pcad05032  Morphine addiction
pcad05034  Alcoholism
pcad05146  Amoebiasis
pcad05163  Human cytomegalovirus infection
pcad05165  Human papillomavirus infection
pcad05166  Human T-cell leukemia virus 1 infection
pcad05200  Pathways in cancer
pcad05203  Viral carcinogenesis
pcad05205  Proteoglycans in cancer
pcad05414  Dilated cardiomyopathy
Brite
KEGG Orthology (KO) [BR:pcad00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04010 MAPK signaling pathway
    102995361 (PRKACA)
   04014 Ras signaling pathway
    102995361 (PRKACA)
   04310 Wnt signaling pathway
    102995361 (PRKACA)
   04340 Hedgehog signaling pathway
    102995361 (PRKACA)
   04371 Apelin signaling pathway
    102995361 (PRKACA)
   04020 Calcium signaling pathway
    102995361 (PRKACA)
   04024 cAMP signaling pathway
    102995361 (PRKACA)
 09140 Cellular Processes
  09141 Transport and catabolism
   04140 Autophagy - animal
    102995361 (PRKACA)
  09143 Cell growth and death
   04114 Oocyte meiosis
    102995361 (PRKACA)
  09144 Cellular community - eukaryotes
   04530 Tight junction
    102995361 (PRKACA)
   04540 Gap junction
    102995361 (PRKACA)
 09150 Organismal Systems
  09151 Immune system
   04611 Platelet activation
    102995361 (PRKACA)
   04062 Chemokine signaling pathway
    102995361 (PRKACA)
  09152 Endocrine system
   04911 Insulin secretion
    102995361 (PRKACA)
   04910 Insulin signaling pathway
    102995361 (PRKACA)
   04922 Glucagon signaling pathway
    102995361 (PRKACA)
   04923 Regulation of lipolysis in adipocytes
    102995361 (PRKACA)
   04912 GnRH signaling pathway
    102995361 (PRKACA)
   04913 Ovarian steroidogenesis
    102995361 (PRKACA)
   04915 Estrogen signaling pathway
    102995361 (PRKACA)
   04914 Progesterone-mediated oocyte maturation
    102995361 (PRKACA)
   04921 Oxytocin signaling pathway
    102995361 (PRKACA)
   04926 Relaxin signaling pathway
    102995361 (PRKACA)
   04935 Growth hormone synthesis, secretion and action
    102995361 (PRKACA)
   04918 Thyroid hormone synthesis
    102995361 (PRKACA)
   04919 Thyroid hormone signaling pathway
    102995361 (PRKACA)
   04928 Parathyroid hormone synthesis, secretion and action
    102995361 (PRKACA)
   04916 Melanogenesis
    102995361 (PRKACA)
   04924 Renin secretion
    102995361 (PRKACA)
   04925 Aldosterone synthesis and secretion
    102995361 (PRKACA)
   04927 Cortisol synthesis and secretion
    102995361 (PRKACA)
  09153 Circulatory system
   04261 Adrenergic signaling in cardiomyocytes
    102995361 (PRKACA)
   04270 Vascular smooth muscle contraction
    102995361 (PRKACA)
  09154 Digestive system
   04970 Salivary secretion
    102995361 (PRKACA)
   04971 Gastric acid secretion
    102995361 (PRKACA)
   04976 Bile secretion
    102995361 (PRKACA)
  09155 Excretory system
   04962 Vasopressin-regulated water reabsorption
    102995361 (PRKACA)
   04961 Endocrine and other factor-regulated calcium reabsorption
    102995361 (PRKACA)
  09156 Nervous system
   04724 Glutamatergic synapse
    102995361 (PRKACA)
   04727 GABAergic synapse
    102995361 (PRKACA)
   04725 Cholinergic synapse
    102995361 (PRKACA)
   04728 Dopaminergic synapse
    102995361 (PRKACA)
   04726 Serotonergic synapse
    102995361 (PRKACA)
   04720 Long-term potentiation
    102995361 (PRKACA)
   04723 Retrograde endocannabinoid signaling
    102995361 (PRKACA)
  09157 Sensory system
   04740 Olfactory transduction
    102995361 (PRKACA)
   04742 Taste transduction
    102995361 (PRKACA)
   04750 Inflammatory mediator regulation of TRP channels
    102995361 (PRKACA)
  09149 Aging
   04211 Longevity regulating pathway
    102995361 (PRKACA)
   04213 Longevity regulating pathway - multiple species
    102995361 (PRKACA)
  09159 Environmental adaptation
   04713 Circadian entrainment
    102995361 (PRKACA)
   04714 Thermogenesis
    102995361 (PRKACA)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    102995361 (PRKACA)
   05205 Proteoglycans in cancer
    102995361 (PRKACA)
   05203 Viral carcinogenesis
    102995361 (PRKACA)
  09164 Neurodegenerative disease
   05012 Parkinson disease
    102995361 (PRKACA)
   05020 Prion disease
    102995361 (PRKACA)
  09165 Substance dependence
   05030 Cocaine addiction
    102995361 (PRKACA)
   05031 Amphetamine addiction
    102995361 (PRKACA)
   05032 Morphine addiction
    102995361 (PRKACA)
   05034 Alcoholism
    102995361 (PRKACA)
  09166 Cardiovascular disease
   05414 Dilated cardiomyopathy
    102995361 (PRKACA)
  09167 Endocrine and metabolic disease
   04934 Cushing syndrome
    102995361 (PRKACA)
  09172 Infectious disease: viral
   05166 Human T-cell leukemia virus 1 infection
    102995361 (PRKACA)
   05163 Human cytomegalovirus infection
    102995361 (PRKACA)
   05165 Human papillomavirus infection
    102995361 (PRKACA)
  09174 Infectious disease: parasitic
   05146 Amoebiasis
    102995361 (PRKACA)
  09176 Drug resistance: antineoplastic
   01522 Endocrine resistance
    102995361 (PRKACA)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01001 Protein kinases [BR:pcad01001]
    102995361 (PRKACA)
  09182 Protein families: genetic information processing
   03019 Messenger RNA biogenesis [BR:pcad03019]
    102995361 (PRKACA)
   03036 Chromosome and associated proteins [BR:pcad03036]
    102995361 (PRKACA)
Enzymes [BR:pcad01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.11  Protein-serine/threonine kinases
    2.7.11.11  cAMP-dependent protein kinase
     102995361 (PRKACA)
Protein kinases [BR:pcad01001]
 Serine/threonine kinases: AGC group
  PKA family
   102995361 (PRKACA)
Messenger RNA biogenesis [BR:pcad03019]
 Eukaryotic type
  mRNA surveillance and transport factors
   mRNA cycle factors
    Common to processing body (P body) and stress granule
     102995361 (PRKACA)
Chromosome and associated proteins [BR:pcad03036]
 Eukaryotic type
  Centrosome formation and ciliogenesis proteins
   Kinases and associated factors
    102995361 (PRKACA)
SSDB
Motif
Pfam: Pkinase PK_Tyr_Ser-Thr Kinase-like
Other DBs
NCBI-GeneID: 102995361
NCBI-ProteinID: XP_023990136
UniProt: A0A2Y9TGS0
LinkDB
Position
Unknown
AA seq 351 aa
MGNAAAAKKGSEQESVKEFLAKAKEDFLKKWENPAQNTAHLDQFERIKTLGTGSFGRVML
VKHKETGSHFAMKILDKQKVVKLKQIEHTLNEKRILQAVNFPFLVKLEFSFKDNSNLYMI
MEYVPGGEMFSHLRRIGRFSEPHARFYAAQIVLTFEYLHSLDLIYRDLKPENLLIDQQGY
IQVTDFGFAKRVKGRTWTLCGTPEYLAPEIILSKGYNKAVDWWALGVLIYEMAAGYPPFF
ADQPIQIYEKIVSGKVRFPSHFSSDLKDLLRNLLQVDLTKRFGNLKNGVNDIKNHKWFAT
TDWIAIYQRKVEAPFIPKFKGPGDTSNFDDYEEEEIRVSINEKCGKEFSEF
NT seq 1056 nt   +upstreamnt  +downstreamnt
atgggcaacgccgccgcggccaagaagggcagcgagcaggagagcgtgaaagagttctta
gccaaagccaaagaagattttcttaaaaaatgggaaaatcctgctcagaatacagcccat
ttggatcagtttgaacgaatcaagaccctcggcacgggctccttcgggcgggtgatgctg
gtgaagcacaaggagaccgggagccactttgccatgaagatcctcgacaaacagaaggtg
gtaaagctgaaacagattgagcacaccctgaacgaaaagcgcatcctgcaagcggtcaac
tttccgttccttgtcaaactcgagttctccttcaaggacaactcaaatttatacatgatc
atggagtacgtgcctggtggggagatgttctcacacctgcggcggatcgggaggttcagt
gagccccatgcccgcttctacgcagcccagattgtcctgaccttcgagtacctgcactcg
ctcgatctcatctaccgggacctgaagccggagaacctccttatcgaccagcagggctac
attcaggtgacagacttcggtttcgccaagcgtgtgaaaggccgcacctggaccttgtgc
ggcacccccgagtacctggcccccgagatcatcctgagtaaaggctacaacaaagctgtg
gactggtgggccctgggggttctcatctatgagatggccgctggctacccgcccttcttc
gctgaccagcccatccagatctatgagaagattgtctctgggaaggtgcggttcccgtcc
cacttcagctccgacctgaaggatctgctgcggaacctcctgcaggtggacctcaccaaa
cgctttgggaacctcaagaacggggtcaatgacatcaagaaccacaagtggtttgccacg
actgactggatcgccatctaccagaggaaggtggaagctcccttcataccaaagtttaaa
ggccctggggacacgagtaactttgacgactatgaggaggaagagatccgagtctccatc
aatgagaagtgtggcaaggagttttctgagttttag

KEGG   Physeter catodon (sperm whale): 112062965
Entry
112062965         CDS       T06011                                 

Definition
(RefSeq) cAMP-dependent protein kinase catalytic subunit beta-like
  KO
K04345  protein kinase A [EC:2.7.11.11]
Organism
pcad  Physeter catodon (sperm whale)
Pathway
pcad01522  Endocrine resistance
pcad04010  MAPK signaling pathway
pcad04014  Ras signaling pathway
pcad04020  Calcium signaling pathway
pcad04024  cAMP signaling pathway
pcad04062  Chemokine signaling pathway
pcad04114  Oocyte meiosis
pcad04140  Autophagy - animal
pcad04211  Longevity regulating pathway
pcad04213  Longevity regulating pathway - multiple species
pcad04261  Adrenergic signaling in cardiomyocytes
pcad04270  Vascular smooth muscle contraction
pcad04310  Wnt signaling pathway
pcad04340  Hedgehog signaling pathway
pcad04371  Apelin signaling pathway
pcad04530  Tight junction
pcad04540  Gap junction
pcad04611  Platelet activation
pcad04713  Circadian entrainment
pcad04714  Thermogenesis
pcad04720  Long-term potentiation
pcad04723  Retrograde endocannabinoid signaling
pcad04724  Glutamatergic synapse
pcad04725  Cholinergic synapse
pcad04726  Serotonergic synapse
pcad04727  GABAergic synapse
pcad04728  Dopaminergic synapse
pcad04740  Olfactory transduction
pcad04742  Taste transduction
pcad04750  Inflammatory mediator regulation of TRP channels
pcad04910  Insulin signaling pathway
pcad04911  Insulin secretion
pcad04912  GnRH signaling pathway
pcad04913  Ovarian steroidogenesis
pcad04914  Progesterone-mediated oocyte maturation
pcad04915  Estrogen signaling pathway
pcad04916  Melanogenesis
pcad04918  Thyroid hormone synthesis
pcad04919  Thyroid hormone signaling pathway
pcad04921  Oxytocin signaling pathway
pcad04922  Glucagon signaling pathway
pcad04923  Regulation of lipolysis in adipocytes
pcad04924  Renin secretion
pcad04925  Aldosterone synthesis and secretion
pcad04926  Relaxin signaling pathway
pcad04927  Cortisol synthesis and secretion
pcad04928  Parathyroid hormone synthesis, secretion and action
pcad04934  Cushing syndrome
pcad04935  Growth hormone synthesis, secretion and action
pcad04961  Endocrine and other factor-regulated calcium reabsorption
pcad04962  Vasopressin-regulated water reabsorption
pcad04970  Salivary secretion
pcad04971  Gastric acid secretion
pcad04976  Bile secretion
pcad05012  Parkinson disease
pcad05020  Prion disease
pcad05030  Cocaine addiction
pcad05031  Amphetamine addiction
pcad05032  Morphine addiction
pcad05034  Alcoholism
pcad05146  Amoebiasis
pcad05163  Human cytomegalovirus infection
pcad05165  Human papillomavirus infection
pcad05166  Human T-cell leukemia virus 1 infection
pcad05200  Pathways in cancer
pcad05203  Viral carcinogenesis
pcad05205  Proteoglycans in cancer
pcad05414  Dilated cardiomyopathy
Brite
KEGG Orthology (KO) [BR:pcad00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04010 MAPK signaling pathway
    112062965
   04014 Ras signaling pathway
    112062965
   04310 Wnt signaling pathway
    112062965
   04340 Hedgehog signaling pathway
    112062965
   04371 Apelin signaling pathway
    112062965
   04020 Calcium signaling pathway
    112062965
   04024 cAMP signaling pathway
    112062965
 09140 Cellular Processes
  09141 Transport and catabolism
   04140 Autophagy - animal
    112062965
  09143 Cell growth and death
   04114 Oocyte meiosis
    112062965
  09144 Cellular community - eukaryotes
   04530 Tight junction
    112062965
   04540 Gap junction
    112062965
 09150 Organismal Systems
  09151 Immune system
   04611 Platelet activation
    112062965
   04062 Chemokine signaling pathway
    112062965
  09152 Endocrine system
   04911 Insulin secretion
    112062965
   04910 Insulin signaling pathway
    112062965
   04922 Glucagon signaling pathway
    112062965
   04923 Regulation of lipolysis in adipocytes
    112062965
   04912 GnRH signaling pathway
    112062965
   04913 Ovarian steroidogenesis
    112062965
   04915 Estrogen signaling pathway
    112062965
   04914 Progesterone-mediated oocyte maturation
    112062965
   04921 Oxytocin signaling pathway
    112062965
   04926 Relaxin signaling pathway
    112062965
   04935 Growth hormone synthesis, secretion and action
    112062965
   04918 Thyroid hormone synthesis
    112062965
   04919 Thyroid hormone signaling pathway
    112062965
   04928 Parathyroid hormone synthesis, secretion and action
    112062965
   04916 Melanogenesis
    112062965
   04924 Renin secretion
    112062965
   04925 Aldosterone synthesis and secretion
    112062965
   04927 Cortisol synthesis and secretion
    112062965
  09153 Circulatory system
   04261 Adrenergic signaling in cardiomyocytes
    112062965
   04270 Vascular smooth muscle contraction
    112062965
  09154 Digestive system
   04970 Salivary secretion
    112062965
   04971 Gastric acid secretion
    112062965
   04976 Bile secretion
    112062965
  09155 Excretory system
   04962 Vasopressin-regulated water reabsorption
    112062965
   04961 Endocrine and other factor-regulated calcium reabsorption
    112062965
  09156 Nervous system
   04724 Glutamatergic synapse
    112062965
   04727 GABAergic synapse
    112062965
   04725 Cholinergic synapse
    112062965
   04728 Dopaminergic synapse
    112062965
   04726 Serotonergic synapse
    112062965
   04720 Long-term potentiation
    112062965
   04723 Retrograde endocannabinoid signaling
    112062965
  09157 Sensory system
   04740 Olfactory transduction
    112062965
   04742 Taste transduction
    112062965
   04750 Inflammatory mediator regulation of TRP channels
    112062965
  09149 Aging
   04211 Longevity regulating pathway
    112062965
   04213 Longevity regulating pathway - multiple species
    112062965
  09159 Environmental adaptation
   04713 Circadian entrainment
    112062965
   04714 Thermogenesis
    112062965
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    112062965
   05205 Proteoglycans in cancer
    112062965
   05203 Viral carcinogenesis
    112062965
  09164 Neurodegenerative disease
   05012 Parkinson disease
    112062965
   05020 Prion disease
    112062965
  09165 Substance dependence
   05030 Cocaine addiction
    112062965
   05031 Amphetamine addiction
    112062965
   05032 Morphine addiction
    112062965
   05034 Alcoholism
    112062965
  09166 Cardiovascular disease
   05414 Dilated cardiomyopathy
    112062965
  09167 Endocrine and metabolic disease
   04934 Cushing syndrome
    112062965
  09172 Infectious disease: viral
   05166 Human T-cell leukemia virus 1 infection
    112062965
   05163 Human cytomegalovirus infection
    112062965
   05165 Human papillomavirus infection
    112062965
  09174 Infectious disease: parasitic
   05146 Amoebiasis
    112062965
  09176 Drug resistance: antineoplastic
   01522 Endocrine resistance
    112062965
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01001 Protein kinases [BR:pcad01001]
    112062965
  09182 Protein families: genetic information processing
   03019 Messenger RNA biogenesis [BR:pcad03019]
    112062965
   03036 Chromosome and associated proteins [BR:pcad03036]
    112062965
Enzymes [BR:pcad01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.11  Protein-serine/threonine kinases
    2.7.11.11  cAMP-dependent protein kinase
     112062965
Protein kinases [BR:pcad01001]
 Serine/threonine kinases: AGC group
  PKA family
   112062965
Messenger RNA biogenesis [BR:pcad03019]
 Eukaryotic type
  mRNA surveillance and transport factors
   mRNA cycle factors
    Common to processing body (P body) and stress granule
     112062965
Chromosome and associated proteins [BR:pcad03036]
 Eukaryotic type
  Centrosome formation and ciliogenesis proteins
   Kinases and associated factors
    112062965
SSDB
Motif
Pfam: Pkinase PK_Tyr_Ser-Thr Kinase-like Seadorna_VP7 Staphopain_pro NUC194
Other DBs
NCBI-GeneID: 112062965
NCBI-ProteinID: XP_028343247
UniProt: A0A455B394
LinkDB
Position
Unknown
AA seq 302 aa
MQKPMLPAGTGKEAFEFGPTLGTGSFGRVKSARYLKSTSTNIDDPTQVPPRVAVKILKKA
AIIKLKHVDHITNEKKILLALDHPFTVRCFGSFHDSRYLYLVLELVPGGEFFTHLRRAKR
FDNDTARFYAAQIVDIFDYLHAQNIIYRDLKPENMLLDKTGYVKLTDFGFAKVVEFRTDT
LCGTPEYIAPEVLLNKGHGKPVDWWTLGVLTFEMIVGYPPFVDDDPLGIYQKILAGKFVF
PKFFDKDAKVLVKKLLQADLSKRWGNLKNGVKDIKECKWFSTISFDELRAKKVVPRYKPT
VK
NT seq 906 nt   +upstreamnt  +downstreamnt
atgcagaagcccatgttacccgcagggacgggcaaggaagcctttgaatttggtcccact
ctcggcactggctccttcggccgcgttaagtctgccaggtatctgaaatccacatccacc
aacatcgatgaccccacgcaagtaccccctcgagtggctgttaagatcctgaagaaagcg
gccatcataaagctaaaacacgttgaccacattacaaacgagaagaaaatcctcctcgcc
ttggatcacccttttactgttcgctgcttcggaagtttccatgatagccgttacctctac
ttggttctggagctcgttccaggcggggaattcttcacccacttaaggcgagctaaaaga
ttcgacaacgacacggcccgcttctacgcagcccagatagtggacattttcgactacctt
cacgcccaaaacattatctacagagatctgaagccggagaatatgcttctggacaaaact
ggatacgtgaaactgacagatttcggctttgcaaaagtagtggaatttcgaacggacacg
ttgtgcggcacgccagagtacattgctccagaagtactcctgaataaaggccacggaaag
cccgtcgattggtggactctgggtgtactcacgttcgagatgatcgttggatatccacct
tttgtggatgatgatccactgggtatttaccagaagatccttgcaggaaaatttgtgttc
cccaaatttttcgataaggacgcaaaggtcttagtgaaaaaacttctacaagccgaccta
tcgaaaagatgggggaatttgaagaatggagtgaaagatattaaagagtgcaagtggttt
tccacgatctccttcgatgaacttagggccaaaaaagtagtgccgcgttataaaccaaca
gtgaag

DBGET integrated database retrieval system