KEGG   Physeter catodon (sperm whale): 102981679
Entry
102981679         CDS       T06011                                 

Gene name
CCND2
Definition
(RefSeq) G1/S-specific cyclin-D2
  KO
K10151  G1/S-specific cyclin-D2
Organism
pcad  Physeter catodon (sperm whale)
Pathway
pcad04068  FoxO signaling pathway
pcad04110  Cell cycle
pcad04115  p53 signaling pathway
pcad04151  PI3K-Akt signaling pathway
pcad04218  Cellular senescence
pcad04310  Wnt signaling pathway
pcad04340  Hedgehog signaling pathway
pcad04390  Hippo signaling pathway
pcad04510  Focal adhesion
pcad04630  JAK-STAT signaling pathway
pcad04917  Prolactin signaling pathway
pcad05162  Measles
pcad05165  Human papillomavirus infection
pcad05166  Human T-cell leukemia virus 1 infection
pcad05169  Epstein-Barr virus infection
pcad05200  Pathways in cancer
pcad05202  Transcriptional misregulation in cancer
pcad05203  Viral carcinogenesis
pcad05206  MicroRNAs in cancer
Brite
KEGG Orthology (KO) [BR:pcad00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04310 Wnt signaling pathway
    102981679 (CCND2)
   04340 Hedgehog signaling pathway
    102981679 (CCND2)
   04390 Hippo signaling pathway
    102981679 (CCND2)
   04630 JAK-STAT signaling pathway
    102981679 (CCND2)
   04068 FoxO signaling pathway
    102981679 (CCND2)
   04151 PI3K-Akt signaling pathway
    102981679 (CCND2)
 09140 Cellular Processes
  09143 Cell growth and death
   04110 Cell cycle
    102981679 (CCND2)
   04115 p53 signaling pathway
    102981679 (CCND2)
   04218 Cellular senescence
    102981679 (CCND2)
  09144 Cellular community - eukaryotes
   04510 Focal adhesion
    102981679 (CCND2)
 09150 Organismal Systems
  09152 Endocrine system
   04917 Prolactin signaling pathway
    102981679 (CCND2)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    102981679 (CCND2)
   05202 Transcriptional misregulation in cancer
    102981679 (CCND2)
   05206 MicroRNAs in cancer
    102981679 (CCND2)
   05203 Viral carcinogenesis
    102981679 (CCND2)
  09172 Infectious disease: viral
   05166 Human T-cell leukemia virus 1 infection
    102981679 (CCND2)
   05162 Measles
    102981679 (CCND2)
   05169 Epstein-Barr virus infection
    102981679 (CCND2)
   05165 Human papillomavirus infection
    102981679 (CCND2)
SSDB
Motif
Pfam: Cyclin_N Cyclin_C K-cyclin_vir_C
Other DBs
NCBI-GeneID: 102981679
NCBI-ProteinID: XP_007117102
UniProt: A0A2Y9F9Z9
LinkDB
Position
6
AA seq 289 aa
MELLCGEVDPVRRAVPDANLLHDDRVLQNLLTIEERYLPQCSYFKCVQKDIQPYMRRMVA
TWMLEVCEEQRCEEEVFPLAINYLDRFLAGVPTPKTHLQLLGAVCMFLASKLKETIPLTA
EKLCIYTDNSIKPQELLEWELVVLGKLKWNLAAVTPHDFIEHILRKLPQPSEKLSLIRKH
AQTFIALCATDFKFAMYPPSMIATGSVGAAICGLQQDEDVSSLTGDALVDLLARITNTDV
DCLKACQEQIEVVLLNSLQQYRQDQGDGAKSEDELDQASTPTDVRDIDL
NT seq 870 nt   +upstreamnt  +downstreamnt
atggagctgctgtgcggagaggtggacccggtccgcagggccgtgccggacgccaacctg
ctccacgacgaccgcgtgctgcagaacttgctgaccatcgaggagcgctaccttccccag
tgctcctacttcaagtgcgtgcagaaggacatccagccctacatgcgcaggatggtggcc
acctggatgctggaggtctgtgaggagcagaggtgcgaagaagaggtctttcctctcgcc
atcaattacctggaccgcttcttggccggggtcccgactccgaagacccatctgcagctt
ctgggggccgtgtgcatgttcctggcctccaagctcaaagagaccataccgctgaccgct
gagaagctttgcatttacacggacaactccatcaagcctcaggaactgctggagtgggag
ctggtggtgctgggcaagttgaagtggaacctggcggccgtcaccccccatgacttcatt
gagcacatccttcgcaagctgcctcagcccagcgagaagctgtctctgatccgcaagcat
gctcagaccttcatcgctctgtgcgccaccgacttcaagttcgccatgtacccgccgtcg
atgatcgcaactggaagcgtgggagccgccatctgcgggctccagcaggacgaggacgtg
agctccctcacgggcgatgccctggtggaccttctggccaggatcaccaacaccgacgtg
gattgcctcaaagcctgccaggagcagattgaggtggtactgctgaacagcctacagcag
taccgtcaggaccagggcgacggagccaagtcggaggacgagctggaccaagccagcacc
cctacagatgtgcgggatattgacctgtga

KEGG   Physeter catodon (sperm whale): 102987349
Entry
102987349         CDS       T06011                                 

Gene name
CCND3
Definition
(RefSeq) G1/S-specific cyclin-D3 isoform X1
  KO
K10152  G1/S-specific cyclin-D3
Organism
pcad  Physeter catodon (sperm whale)
Pathway
pcad04110  Cell cycle
pcad04115  p53 signaling pathway
pcad04151  PI3K-Akt signaling pathway
pcad04218  Cellular senescence
pcad04310  Wnt signaling pathway
pcad04390  Hippo signaling pathway
pcad04510  Focal adhesion
pcad04630  JAK-STAT signaling pathway
pcad05162  Measles
pcad05164  Influenza A
pcad05165  Human papillomavirus infection
pcad05166  Human T-cell leukemia virus 1 infection
pcad05169  Epstein-Barr virus infection
pcad05200  Pathways in cancer
pcad05203  Viral carcinogenesis
Brite
KEGG Orthology (KO) [BR:pcad00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04310 Wnt signaling pathway
    102987349 (CCND3)
   04390 Hippo signaling pathway
    102987349 (CCND3)
   04630 JAK-STAT signaling pathway
    102987349 (CCND3)
   04151 PI3K-Akt signaling pathway
    102987349 (CCND3)
 09140 Cellular Processes
  09143 Cell growth and death
   04110 Cell cycle
    102987349 (CCND3)
   04115 p53 signaling pathway
    102987349 (CCND3)
   04218 Cellular senescence
    102987349 (CCND3)
  09144 Cellular community - eukaryotes
   04510 Focal adhesion
    102987349 (CCND3)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    102987349 (CCND3)
   05203 Viral carcinogenesis
    102987349 (CCND3)
  09172 Infectious disease: viral
   05166 Human T-cell leukemia virus 1 infection
    102987349 (CCND3)
   05164 Influenza A
    102987349 (CCND3)
   05162 Measles
    102987349 (CCND3)
   05169 Epstein-Barr virus infection
    102987349 (CCND3)
   05165 Human papillomavirus infection
    102987349 (CCND3)
SSDB
Motif
Pfam: Cyclin_N Cyclin_C K-cyclin_vir_C
Other DBs
NCBI-GeneID: 102987349
NCBI-ProteinID: XP_007120363
UniProt: A0A2Y9FDQ2
LinkDB
Position
18
AA seq 358 aa
MELLCCEGTRHAPRAGPDPRLLGDQRVLQSLLRLEERYVPRASYFQCVQREIKPHMRKML
AYWMLEVCEEQRCEEEVFPLAMNYLDRYLSCVPTRKAQLQLLGAVCMLLASKLRETTPLT
IEKLCIYTDHSVSPRQLREKQLLPNSPFASLTLGNLSSCFRPVESSLLFLFSQRPELRHR
LGLSCSCFRCDNDALSPGPPTLTKDWEVLVLGKLKWDLAAVIAHDFLALILHRLSLPRDR
QALVKKHAQTFLALCATDYTFAMYPPSMIATGSIGAAVQGLGACSTSGDELTELLAGITG
TEVDCLRACQEQIEAALRESLREAAQTSPSPAPKAPRGSSSQGPSQTSTPTDVTAIHL
NT seq 1077 nt   +upstreamnt  +downstreamnt
atggagctgctgtgctgcgagggcacccggcacgcgccccgggccgggccggacccgcgg
ctgctgggggaccagcgtgtcctgcagagcttgctccgcctggaagagcgctacgtgccc
cgcgcctcttacttccagtgtgtgcagagggagatcaagccgcacatgcggaagatgctg
gcgtactggatgctggaggtgtgtgaggagcagcgctgtgaggaggaagtcttccccctg
gccatgaactacctggatcgctacctgtcctgcgtccccacccgcaaggcgcagttgcag
ctcctgggtgcggtctgcatgctgctggcctccaagctgcgcgagactacgcccctgacc
atcgaaaaactgtgcatctacaccgaccactctgtctctccccgccagctgcgggagaaa
cagctccttcctaattctccgttcgctagcctcactctgggaaacttgagcagctgcttc
aggcctgtggaatcatctcttcttttcctctttagccaaaggccagagctgaggcacaga
ctggggctgagctgcagctgcttccgatgtgataatgatgccctgtcccccggcccaccc
actctgaccaaggactgggaggtgctggtcctggggaagctcaagtgggacctggccgcc
gtgattgcccatgatttcctggccctgattctgcaccggctctctctgccccgtgaccga
caggccttggtcaagaagcacgcccagacttttttggccctctgtgctacagattacacc
tttgccatgtacccgccatccatgattgccacgggaagcattggagctgcagtgcaaggc
ctgggtgcctgctccacatctggggatgagctcacagagctgctggcagggatcacaggc
actgaagtggactgcctgcgggcctgtcaggagcagattgaagctgccctcagggagagc
ctcagggaagccgcccagacctcccccagcccagcgcccaaagcccccaggggctccagc
agccaggggcccagccagaccagcactcccacagatgtcacagccatccacctgtag

KEGG   Physeter catodon (sperm whale): 102996914
Entry
102996914         CDS       T06011                                 

Gene name
CCND1
Definition
(RefSeq) G1/S-specific cyclin-D1
  KO
K04503  G1/S-specific cyclin-D1
Organism
pcad  Physeter catodon (sperm whale)
Pathway
pcad01522  Endocrine resistance
pcad04068  FoxO signaling pathway
pcad04110  Cell cycle
pcad04115  p53 signaling pathway
pcad04151  PI3K-Akt signaling pathway
pcad04152  AMPK signaling pathway
pcad04218  Cellular senescence
pcad04310  Wnt signaling pathway
pcad04340  Hedgehog signaling pathway
pcad04371  Apelin signaling pathway
pcad04390  Hippo signaling pathway
pcad04510  Focal adhesion
pcad04530  Tight junction
pcad04630  JAK-STAT signaling pathway
pcad04917  Prolactin signaling pathway
pcad04919  Thyroid hormone signaling pathway
pcad04921  Oxytocin signaling pathway
pcad04933  AGE-RAGE signaling pathway in diabetic complications
pcad04934  Cushing syndrome
pcad05160  Hepatitis C
pcad05162  Measles
pcad05163  Human cytomegalovirus infection
pcad05165  Human papillomavirus infection
pcad05166  Human T-cell leukemia virus 1 infection
pcad05167  Kaposi sarcoma-associated herpesvirus infection
pcad05169  Epstein-Barr virus infection
pcad05200  Pathways in cancer
pcad05203  Viral carcinogenesis
pcad05205  Proteoglycans in cancer
pcad05206  MicroRNAs in cancer
pcad05210  Colorectal cancer
pcad05212  Pancreatic cancer
pcad05213  Endometrial cancer
pcad05214  Glioma
pcad05215  Prostate cancer
pcad05216  Thyroid cancer
pcad05218  Melanoma
pcad05219  Bladder cancer
pcad05220  Chronic myeloid leukemia
pcad05221  Acute myeloid leukemia
pcad05222  Small cell lung cancer
pcad05223  Non-small cell lung cancer
pcad05224  Breast cancer
pcad05225  Hepatocellular carcinoma
pcad05226  Gastric cancer
pcad05416  Viral myocarditis
Brite
KEGG Orthology (KO) [BR:pcad00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04310 Wnt signaling pathway
    102996914 (CCND1)
   04340 Hedgehog signaling pathway
    102996914 (CCND1)
   04390 Hippo signaling pathway
    102996914 (CCND1)
   04371 Apelin signaling pathway
    102996914 (CCND1)
   04630 JAK-STAT signaling pathway
    102996914 (CCND1)
   04068 FoxO signaling pathway
    102996914 (CCND1)
   04151 PI3K-Akt signaling pathway
    102996914 (CCND1)
   04152 AMPK signaling pathway
    102996914 (CCND1)
 09140 Cellular Processes
  09143 Cell growth and death
   04110 Cell cycle
    102996914 (CCND1)
   04115 p53 signaling pathway
    102996914 (CCND1)
   04218 Cellular senescence
    102996914 (CCND1)
  09144 Cellular community - eukaryotes
   04510 Focal adhesion
    102996914 (CCND1)
   04530 Tight junction
    102996914 (CCND1)
 09150 Organismal Systems
  09152 Endocrine system
   04917 Prolactin signaling pathway
    102996914 (CCND1)
   04921 Oxytocin signaling pathway
    102996914 (CCND1)
   04919 Thyroid hormone signaling pathway
    102996914 (CCND1)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    102996914 (CCND1)
   05206 MicroRNAs in cancer
    102996914 (CCND1)
   05205 Proteoglycans in cancer
    102996914 (CCND1)
   05203 Viral carcinogenesis
    102996914 (CCND1)
  09162 Cancer: specific types
   05210 Colorectal cancer
    102996914 (CCND1)
   05212 Pancreatic cancer
    102996914 (CCND1)
   05225 Hepatocellular carcinoma
    102996914 (CCND1)
   05226 Gastric cancer
    102996914 (CCND1)
   05214 Glioma
    102996914 (CCND1)
   05216 Thyroid cancer
    102996914 (CCND1)
   05221 Acute myeloid leukemia
    102996914 (CCND1)
   05220 Chronic myeloid leukemia
    102996914 (CCND1)
   05218 Melanoma
    102996914 (CCND1)
   05219 Bladder cancer
    102996914 (CCND1)
   05215 Prostate cancer
    102996914 (CCND1)
   05213 Endometrial cancer
    102996914 (CCND1)
   05224 Breast cancer
    102996914 (CCND1)
   05222 Small cell lung cancer
    102996914 (CCND1)
   05223 Non-small cell lung cancer
    102996914 (CCND1)
  09166 Cardiovascular disease
   05416 Viral myocarditis
    102996914 (CCND1)
  09167 Endocrine and metabolic disease
   04933 AGE-RAGE signaling pathway in diabetic complications
    102996914 (CCND1)
   04934 Cushing syndrome
    102996914 (CCND1)
  09172 Infectious disease: viral
   05166 Human T-cell leukemia virus 1 infection
    102996914 (CCND1)
   05160 Hepatitis C
    102996914 (CCND1)
   05162 Measles
    102996914 (CCND1)
   05163 Human cytomegalovirus infection
    102996914 (CCND1)
   05167 Kaposi sarcoma-associated herpesvirus infection
    102996914 (CCND1)
   05169 Epstein-Barr virus infection
    102996914 (CCND1)
   05165 Human papillomavirus infection
    102996914 (CCND1)
  09176 Drug resistance: antineoplastic
   01522 Endocrine resistance
    102996914 (CCND1)
SSDB
Motif
Pfam: Cyclin_N Cyclin_C
Other DBs
NCBI-GeneID: 102996914
NCBI-ProteinID: XP_023989054
UniProt: A0A2Y9TJV6
LinkDB
Position
18
AA seq 295 aa
MAHQLLCCEMETIRRAYPDANLLNDRVLRAMLKAEETCAPSVSYFKCVQKEILPSMRKIV
ATWMLEVCEEQKCEEEVFPLAMNYLDRFLSLEPVKKSRLQLLGATCMFVASKMKETIPLT
AEKLCIYTDNSIRPDELLQMELVLVNKLKWNLAATTPHDFIEHFLSKMPVVEENKQIIRK
HAQTFVALCATDVKFISNPPSMVAAGSVVAAVQGLHLGSANSFLSYHRLTRFLSKVIRCD
PDCLRACQEQIEALLESSLRQAQQQNLDPKAAEEEEEEEEVDLACTPTDVRDVDI
NT seq 888 nt   +upstreamnt  +downstreamnt
atggcacaccagctcctgtgctgcgagatggagaccatccgccgggcgtaccccgatgcc
aacctcctcaacgaccgggtgctgcgggccatgctcaaggcggaggagacctgcgcgccc
tcggtgtcctacttcaagtgtgtgcagaaggagatcctgccgtccatgcggaagatcgta
gccacctggatgctggaggtctgcgaggagcaaaagtgcgaggaggaggtcttcccgctg
gccatgaactacctggaccgcttcctgtcgctggagcccgtgaaaaagagccgcctgcag
ctgctgggggccacctgcatgttcgtcgcctcgaagatgaaggagaccatcccgctgacg
gccgagaagctgtgcatctacactgacaactccattcggcccgacgagctgctgcaaatg
gagctggtcttggtgaacaaactcaagtggaacctggctgccacgaccccgcacgacttc
attgaacacttcctctccaaaatgccggtggtcgaggagaacaaacagatcatccgcaaa
cacgcgcagaccttcgttgccctctgtgccacagatgtgaagttcatttccaacccgccc
tccatggtggctgccgggagcgtggtggccgcggtgcaaggcctgcacctgggaagcgcc
aacagcttcctgtcctatcaccgcctgacgcggttcctctccaaagtgatcaggtgtgac
ccggactgcctccgcgcctgccaggagcagatcgaagccctcctggagtccagcctgcgc
caggcccagcagcagaacttggaccccaaggccgcggaggaggaggaggaggaggaggag
gtggacctggcctgcacgcccaccgacgtgcgtgacgtggacatttga

DBGET integrated database retrieval system