KEGG   Physeter catodon (sperm whale): 102981739
Entry
102981739         CDS       T06011                                 

Gene name
VEGFA
Definition
(RefSeq) vascular endothelial growth factor A isoform X5
  KO
K05448  vascular endothelial growth factor A
Organism
pcad  Physeter catodon (sperm whale)
Pathway
pcad01521  EGFR tyrosine kinase inhibitor resistance
pcad04010  MAPK signaling pathway
pcad04014  Ras signaling pathway
pcad04015  Rap1 signaling pathway
pcad04020  Calcium signaling pathway
pcad04066  HIF-1 signaling pathway
pcad04151  PI3K-Akt signaling pathway
pcad04370  VEGF signaling pathway
pcad04510  Focal adhesion
pcad04926  Relaxin signaling pathway
pcad04933  AGE-RAGE signaling pathway in diabetic complications
pcad05163  Human cytomegalovirus infection
pcad05165  Human papillomavirus infection
pcad05167  Kaposi sarcoma-associated herpesvirus infection
pcad05200  Pathways in cancer
pcad05205  Proteoglycans in cancer
pcad05206  MicroRNAs in cancer
pcad05211  Renal cell carcinoma
pcad05212  Pancreatic cancer
pcad05219  Bladder cancer
pcad05323  Rheumatoid arthritis
pcad05418  Fluid shear stress and atherosclerosis
Brite
KEGG Orthology (KO) [BR:pcad00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04010 MAPK signaling pathway
    102981739 (VEGFA)
   04014 Ras signaling pathway
    102981739 (VEGFA)
   04015 Rap1 signaling pathway
    102981739 (VEGFA)
   04370 VEGF signaling pathway
    102981739 (VEGFA)
   04066 HIF-1 signaling pathway
    102981739 (VEGFA)
   04020 Calcium signaling pathway
    102981739 (VEGFA)
   04151 PI3K-Akt signaling pathway
    102981739 (VEGFA)
 09140 Cellular Processes
  09144 Cellular community - eukaryotes
   04510 Focal adhesion
    102981739 (VEGFA)
 09150 Organismal Systems
  09152 Endocrine system
   04926 Relaxin signaling pathway
    102981739 (VEGFA)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    102981739 (VEGFA)
   05206 MicroRNAs in cancer
    102981739 (VEGFA)
   05205 Proteoglycans in cancer
    102981739 (VEGFA)
  09162 Cancer: specific types
   05212 Pancreatic cancer
    102981739 (VEGFA)
   05211 Renal cell carcinoma
    102981739 (VEGFA)
   05219 Bladder cancer
    102981739 (VEGFA)
  09163 Immune disease
   05323 Rheumatoid arthritis
    102981739 (VEGFA)
  09166 Cardiovascular disease
   05418 Fluid shear stress and atherosclerosis
    102981739 (VEGFA)
  09167 Endocrine and metabolic disease
   04933 AGE-RAGE signaling pathway in diabetic complications
    102981739 (VEGFA)
  09172 Infectious disease: viral
   05163 Human cytomegalovirus infection
    102981739 (VEGFA)
   05167 Kaposi sarcoma-associated herpesvirus infection
    102981739 (VEGFA)
   05165 Human papillomavirus infection
    102981739 (VEGFA)
  09176 Drug resistance: antineoplastic
   01521 EGFR tyrosine kinase inhibitor resistance
    102981739 (VEGFA)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04052 Cytokines and growth factors [BR:pcad04052]
    102981739 (VEGFA)
   00536 Glycosaminoglycan binding proteins [BR:pcad00536]
    102981739 (VEGFA)
Cytokines and growth factors [BR:pcad04052]
 Growth factors
  Growth factors (RTK binding)
   102981739 (VEGFA)
Glycosaminoglycan binding proteins [BR:pcad00536]
 Heparan sulfate / Heparin
  Growth factors/receptors
   102981739 (VEGFA)
SSDB
Motif
Pfam: VEGF_C PDGF
Other DBs
NCBI-GeneID: 102981739
NCBI-ProteinID: XP_023977547
UniProt: A0A2Y9SJI7
LinkDB
Position
Unknown
AA seq 214 aa
MNFLLSWVHWSLALLLYLHHAKWSQAAPMAEGEQKPHEVVKFMDVYQRSYCRPIETLVDI
FQEYPDEIEYIFKPSCVPLMRCGGCCNDEGLECVPTEEFNITMQIMRIKPHQGQHIGEMS
FLQHNKCECRPKKDRARQEKKSVRGKGKGQKRKRKKSRYKSWSAPCGPCSERRKHLFVQD
PQTCKCSCKNTDSRCKARQLELNERTCRCDKPRR
NT seq 645 nt   +upstreamnt  +downstreamnt
atgaactttctgctctcttgggtgcattggagccttgccttgctgctctacctccaccat
gccaagtggtcccaggctgcacccatggcagaaggagaacagaaacctcacgaagtggtg
aagttcatggacgtctaccagcgcagctactgccgtccaattgagaccctggtggacatc
ttccaggagtaccccgatgagatcgagtacatcttcaagccgtcctgtgtgcccctgatg
cggtgtgggggctgctgcaatgacgagggtctggagtgtgtgcccaccgaagagttcaac
atcaccatgcagattatgcggatcaaacctcaccaaggccagcacataggagagatgagc
ttcctacagcacaacaaatgtgaatgcagaccaaagaaagatagagcaaggcaagaaaaa
aaatcagttcgaggaaagggaaaggggcaaaaaagaaagcgcaagaaatcccggtataaa
tcctggagcgctccctgtgggccttgctcagagcggagaaagcatttgtttgtacaagat
ccacagacgtgtaaatgttcctgcaaaaacacagactcgcgttgcaaggcgaggcagctt
gagttaaacgaacgtacttgcagatgtgacaagccaaggcggtga

DBGET integrated database retrieval system