KEGG   Physeter catodon (sperm whale): 102981745
Entry
102981745         CDS       T06011                                 

Definition
(RefSeq) LOW QUALITY PROTEIN: histone deacetylase 1-like
  KO
K06067  histone deacetylase 1/2 [EC:3.5.1.98]
Organism
pcad  Physeter catodon (sperm whale)
Pathway
pcad04110  Cell cycle
pcad04213  Longevity regulating pathway - multiple species
pcad04330  Notch signaling pathway
pcad04613  Neutrophil extracellular trap formation
pcad04919  Thyroid hormone signaling pathway
pcad05016  Huntington disease
pcad05031  Amphetamine addiction
pcad05034  Alcoholism
pcad05165  Human papillomavirus infection
pcad05169  Epstein-Barr virus infection
pcad05200  Pathways in cancer
pcad05202  Transcriptional misregulation in cancer
pcad05203  Viral carcinogenesis
pcad05206  MicroRNAs in cancer
pcad05220  Chronic myeloid leukemia
Brite
KEGG Orthology (KO) [BR:pcad00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04330 Notch signaling pathway
    102981745
 09140 Cellular Processes
  09143 Cell growth and death
   04110 Cell cycle
    102981745
 09150 Organismal Systems
  09151 Immune system
   04613  Neutrophil extracellular trap formation
    102981745
  09152 Endocrine system
   04919 Thyroid hormone signaling pathway
    102981745
  09149 Aging
   04213 Longevity regulating pathway - multiple species
    102981745
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    102981745
   05202 Transcriptional misregulation in cancer
    102981745
   05206 MicroRNAs in cancer
    102981745
   05203 Viral carcinogenesis
    102981745
  09162 Cancer: specific types
   05220 Chronic myeloid leukemia
    102981745
  09164 Neurodegenerative disease
   05016 Huntington disease
    102981745
  09165 Substance dependence
   05031 Amphetamine addiction
    102981745
   05034 Alcoholism
    102981745
  09172 Infectious disease: viral
   05169 Epstein-Barr virus infection
    102981745
   05165 Human papillomavirus infection
    102981745
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03036 Chromosome and associated proteins [BR:pcad03036]
    102981745
Enzymes [BR:pcad01000]
 3. Hydrolases
  3.5  Acting on carbon-nitrogen bonds, other than peptide bonds
   3.5.1  In linear amides
    3.5.1.98  histone deacetylase
     102981745
Chromosome and associated proteins [BR:pcad03036]
 Eukaryotic type
  Histone modification proteins
   HDACs (histone deacetylases)
    Class I HDACs
     102981745
   HDAC complexes
    Sin3A-HDAC complex
     102981745
    BRAF-HDAC complex
     102981745
  Heterochromatin formation proteins
   Other heterochromatin formation proteins
    102981745
  Chromatin remodeling factors
   NuRD complex
    102981745
SSDB
Motif
Pfam: Hist_deacetyl
Other DBs
NCBI-GeneID: 102981745
NCBI-ProteinID: XP_023983953
UniProt: A0A2Y9T0P5
LinkDB
Position
21
AA seq 485 aa
MAQTQGTRGKVCYSYDGDVSNYVVYYGQGHPMKPHXICMTRNLLLNYGLDRKMEVHHPRK
ANAEERTKYHTDDYITFLRSICPDNMSEYGRQMQRFYVGEDCPVFDGLFEFCQLSPGGSV
ASALXNKQQTDITVNWAGGLHHAKKSEASGFCYVNVNDIILAILELLKYHQRVLYIDIDI
HHGDGVEEAFYTTDRVMTVSFHEYGEYFPGTWDLWDIGIGKGKYYAVNYPLRDGIDDESY
EAIFKLVMSKVTEMFQLSAVVFHCGSDFLSGDQLDCFDSTIKGQAKCVEFVKSFNLPVLM
LGGGGYTIXNVSRCWTYETAVALDMEIPNELSYNDYFEYFGPDFKFHISLSNMTNQNTNE
YLEKLKQGLFENLRMLTRIPGVQMQAIPEDAIPEESGDEDEEDPDKHISLCSSDKQIACE
EEFSDSDEEGKGGRKNSSNFKKAKRVKTEDEKEKDPEEKKEVTEEEKTKEEKQEAKRVQE
EVNLA
NT seq 1458 nt   +upstreamnt  +downstreamnt
atggcgcagactcagggcaccagggggaaagtctgttactcctacgacggtgatgtttcc
aattatgttgtatattacggacaaggccacccaatgaagcctcactgaatctgcatgact
cgcaatttgctccttaactatggcctcgaccgaaagatggaagttcatcaccctcgcaaa
gccaatgctgaggagagaaccaagtaccacactgatgattacattacattcttgcgctcc
atctgtccagataacatgtccgagtacggcaggcagatgcagagattctacgttggtgag
gactgtccggtatttgatggcctgtttgagttctgtcagctatctcctggtggctctgtg
gcaagtgccctgnaaaataaacagcagacggacatcactgtgaattgggctgggggctta
caccatgcaaagaagtccgaggcatctggcttctgttacgtcaatgtcaatgatatcatc
ttggctatcctggaactgctgaagtatcaccagagagtgctgtatattgacattgatatt
caccatggcgatggcgtggaagaggccttctataccacagaccgagtcatgactgtgtcc
tttcatgaatatggagagtacttcccaggaacttgggacctatgggatattgggattggc
aaaggcaagtattatgctgttaactacccactccgagatgggattgatgacgagtcctat
gaggccattttcaagctggtcatgtccaaagtaacggagatgttccagctcagtgcagtc
gtctttcactgtggctctgatttcttgtctggggatcagttagattgcttcgattcgacc
atcaaagggcaagccaagtgtgtggaatttgtgaagagctttaacctgcctgtgctgatg
ctgggaggaggtggctacaccattnataatgtctcccggtgctggacttatgaaacagct
gtggccctggacatggagatccctaatgagctttcatacaatgactactttgaatacttt
ggcccagatttcaaatttcacatcagtctttccaatatgactaaccagaacactaatgag
tacctggaaaagctcaaacagggactgtttgagaacctgagaatgctgacccgcatacct
ggggtccaaatgcaggccattcctgaggatgccattccagaggagagtggtgatgaggat
gaagaagaccctgacaagcacatctcactctgttcctcggacaaacaaattgcctgtgag
gaagagttctccgactctgatgaggagggaaaaggaggtcgcaagaactcttccaacttc
aaaaaagccaagagagtcaaaacagaagatgagaaagagaaagacccagaagaaaagaaa
gaagtcacagaagaggagaaaaccaaggaggagaagcaagaagccaagagggtccaggag
gaggtcaatttggcctga

KEGG   Physeter catodon (sperm whale): 102991367
Entry
102991367         CDS       T06011                                 

Gene name
HDAC1
Definition
(RefSeq) histone deacetylase 1 isoform X1
  KO
K06067  histone deacetylase 1/2 [EC:3.5.1.98]
Organism
pcad  Physeter catodon (sperm whale)
Pathway
pcad04110  Cell cycle
pcad04213  Longevity regulating pathway - multiple species
pcad04330  Notch signaling pathway
pcad04613  Neutrophil extracellular trap formation
pcad04919  Thyroid hormone signaling pathway
pcad05016  Huntington disease
pcad05031  Amphetamine addiction
pcad05034  Alcoholism
pcad05165  Human papillomavirus infection
pcad05169  Epstein-Barr virus infection
pcad05200  Pathways in cancer
pcad05202  Transcriptional misregulation in cancer
pcad05203  Viral carcinogenesis
pcad05206  MicroRNAs in cancer
pcad05220  Chronic myeloid leukemia
Brite
KEGG Orthology (KO) [BR:pcad00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04330 Notch signaling pathway
    102991367 (HDAC1)
 09140 Cellular Processes
  09143 Cell growth and death
   04110 Cell cycle
    102991367 (HDAC1)
 09150 Organismal Systems
  09151 Immune system
   04613  Neutrophil extracellular trap formation
    102991367 (HDAC1)
  09152 Endocrine system
   04919 Thyroid hormone signaling pathway
    102991367 (HDAC1)
  09149 Aging
   04213 Longevity regulating pathway - multiple species
    102991367 (HDAC1)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    102991367 (HDAC1)
   05202 Transcriptional misregulation in cancer
    102991367 (HDAC1)
   05206 MicroRNAs in cancer
    102991367 (HDAC1)
   05203 Viral carcinogenesis
    102991367 (HDAC1)
  09162 Cancer: specific types
   05220 Chronic myeloid leukemia
    102991367 (HDAC1)
  09164 Neurodegenerative disease
   05016 Huntington disease
    102991367 (HDAC1)
  09165 Substance dependence
   05031 Amphetamine addiction
    102991367 (HDAC1)
   05034 Alcoholism
    102991367 (HDAC1)
  09172 Infectious disease: viral
   05169 Epstein-Barr virus infection
    102991367 (HDAC1)
   05165 Human papillomavirus infection
    102991367 (HDAC1)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03036 Chromosome and associated proteins [BR:pcad03036]
    102991367 (HDAC1)
Enzymes [BR:pcad01000]
 3. Hydrolases
  3.5  Acting on carbon-nitrogen bonds, other than peptide bonds
   3.5.1  In linear amides
    3.5.1.98  histone deacetylase
     102991367 (HDAC1)
Chromosome and associated proteins [BR:pcad03036]
 Eukaryotic type
  Histone modification proteins
   HDACs (histone deacetylases)
    Class I HDACs
     102991367 (HDAC1)
   HDAC complexes
    Sin3A-HDAC complex
     102991367 (HDAC1)
    BRAF-HDAC complex
     102991367 (HDAC1)
  Heterochromatin formation proteins
   Other heterochromatin formation proteins
    102991367 (HDAC1)
  Chromatin remodeling factors
   NuRD complex
    102991367 (HDAC1)
SSDB
Motif
Pfam: Hist_deacetyl SAE2 RNA_polI_A34
Other DBs
NCBI-GeneID: 102991367
NCBI-ProteinID: XP_028341677
UniProt: A0A455AYQ7
LinkDB
Position
Unknown
AA seq 422 aa
MFFQVNVGEDCPVFDGLFEFCQLSTGGSVASAVKLNKQQTDIAVNWAGGLHHAKKSEASG
FCYVNDIVLAILELLKYHQRVLYIDIDIHHGDGVEEAFYTTDRVMTVSFHKYGEYFPGTG
DLRDIGAGKGKYYAVNYPLRDGIDDESYEAIFKPVMSKVMEMFQPSAVVLQCGSDSLSGD
RLGCFNLTIKGHAKCVEFVKSFNLPMLMLGGGGYTIRNVARCWTYETAVALDTEIPNELP
YNDYFEYFGPDFKLHISPSNMTNQNTNEYLEKIKQRLFENLRMLPHAPGVQMQAIPEDAI
PEESGDEDEEDPDKRISICSSDKRIACEEEFSDSDEEGEGGRKNSSNFKKAKRVKTEDEK
EKDPEEKKGSRRRSSWPEQTSPLQFWLLAKFPTFIPQPLRFYIFYFSVYLYKNILNINIP
RD
NT seq 1269 nt   +upstreamnt  +downstreamnt
atgttttttcaagttaacgttggtgaggactgtccggtatttgatggcctctttgagttc
tgtcagctatctactggtggctctgtggcaagtgccgtgaaacttaataagcagcagacg
gacatcgctgtgaattgggctgggggcctacaccatgcaaagaagtccgaggcatctggc
ttctgttacgtcaatgatatcgtcttggccatcctggaactgctaaagtatcaccagagg
gtgctgtatattgacattgatattcaccacggcgatggcgtggaagaggccttctatacc
acagaccgagtcatgactgtgtcctttcataaatatggagagtacttcccaggaactggg
gacctacgggatatcggggctggcaaaggcaagtattatgctgttaactacccgctccga
gatgggattgatgacgagtcctatgaggccattttcaagccggtcatgtccaaagtaatg
gagatgttccagcccagtgcagtcgtcttacagtgtggctctgactccttgtctggtgat
cggttaggttgcttcaacttgaccatcaaagggcacgccaagtgtgtggaatttgtgaag
agcttcaacctgcctatgctgatgctgggaggaggtggctacaccattcgtaatgtcgcc
cggtgctggacgtacgaaacagctgtggccctggacacggagatccctaatgagcttcca
tacaacgactacttcgaatactttggaccagatttcaaacttcacatcagcccttccaat
atgactaaccagaacactaatgagtacctggaaaagatcaaacagcgactgtttgagaac
ctgagaatgctgccccatgcacctggggtccaaatgcaggccattcctgaggatgccatt
ccagaggagagtggcgatgaggatgaagaagaccctgacaagcgcatttcaatctgttcc
tcggacaaacgaattgcctgtgaggaagagttctccgactctgacgaggagggagaaggc
ggtcgcaagaactcttccaacttcaaaaaagccaagagagtcaaaacagaagacgagaaa
gagaaagacccagaagagaagaaagggtcaaggaggaggtcaagttggcctgaacagacc
tctcctctccagttctggcttcttgccaagttccccacctttatcccacaacccctcaga
ttttatattttctatttctctgtgtatttatataaaaatatattaaatataaatatcccc
agggactag

KEGG   Physeter catodon (sperm whale): 102993806
Entry
102993806         CDS       T06011                                 

Gene name
HDAC2
Definition
(RefSeq) histone deacetylase 2 isoform X7
  KO
K06067  histone deacetylase 1/2 [EC:3.5.1.98]
Organism
pcad  Physeter catodon (sperm whale)
Pathway
pcad04110  Cell cycle
pcad04213  Longevity regulating pathway - multiple species
pcad04330  Notch signaling pathway
pcad04613  Neutrophil extracellular trap formation
pcad04919  Thyroid hormone signaling pathway
pcad05016  Huntington disease
pcad05031  Amphetamine addiction
pcad05034  Alcoholism
pcad05165  Human papillomavirus infection
pcad05169  Epstein-Barr virus infection
pcad05200  Pathways in cancer
pcad05202  Transcriptional misregulation in cancer
pcad05203  Viral carcinogenesis
pcad05206  MicroRNAs in cancer
pcad05220  Chronic myeloid leukemia
Brite
KEGG Orthology (KO) [BR:pcad00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04330 Notch signaling pathway
    102993806 (HDAC2)
 09140 Cellular Processes
  09143 Cell growth and death
   04110 Cell cycle
    102993806 (HDAC2)
 09150 Organismal Systems
  09151 Immune system
   04613  Neutrophil extracellular trap formation
    102993806 (HDAC2)
  09152 Endocrine system
   04919 Thyroid hormone signaling pathway
    102993806 (HDAC2)
  09149 Aging
   04213 Longevity regulating pathway - multiple species
    102993806 (HDAC2)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    102993806 (HDAC2)
   05202 Transcriptional misregulation in cancer
    102993806 (HDAC2)
   05206 MicroRNAs in cancer
    102993806 (HDAC2)
   05203 Viral carcinogenesis
    102993806 (HDAC2)
  09162 Cancer: specific types
   05220 Chronic myeloid leukemia
    102993806 (HDAC2)
  09164 Neurodegenerative disease
   05016 Huntington disease
    102993806 (HDAC2)
  09165 Substance dependence
   05031 Amphetamine addiction
    102993806 (HDAC2)
   05034 Alcoholism
    102993806 (HDAC2)
  09172 Infectious disease: viral
   05169 Epstein-Barr virus infection
    102993806 (HDAC2)
   05165 Human papillomavirus infection
    102993806 (HDAC2)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03036 Chromosome and associated proteins [BR:pcad03036]
    102993806 (HDAC2)
Enzymes [BR:pcad01000]
 3. Hydrolases
  3.5  Acting on carbon-nitrogen bonds, other than peptide bonds
   3.5.1  In linear amides
    3.5.1.98  histone deacetylase
     102993806 (HDAC2)
Chromosome and associated proteins [BR:pcad03036]
 Eukaryotic type
  Histone modification proteins
   HDACs (histone deacetylases)
    Class I HDACs
     102993806 (HDAC2)
   HDAC complexes
    Sin3A-HDAC complex
     102993806 (HDAC2)
    BRAF-HDAC complex
     102993806 (HDAC2)
  Heterochromatin formation proteins
   Other heterochromatin formation proteins
    102993806 (HDAC2)
  Chromatin remodeling factors
   NuRD complex
    102993806 (HDAC2)
SSDB
Motif
Pfam: Hist_deacetyl
Other DBs
NCBI-GeneID: 102993806
NCBI-ProteinID: XP_023971341
UniProt: A0A2Y9RXT7
LinkDB
Position
10
AA seq 488 aa
MAYSQGGGKKKVCYYYDGDIGNYYYGQGHPMKPHRIRMTHNLLLNYGLYRKMEIYRPHKA
TAEEMTKYHSDEYIKFLRSIRPDNMSEYSKQMQRFNVGEDCPVFDGLFEFCQLSTGGSVA
GAVKLNRQQTDMAVNWAGGLHHAKKSEASGFCYVNDIVLAILELLKYHQRVLYIDIDIHH
GDGVEEAFYTTDRVMTVSFHKYGEYFPGTGDLRDIGAGKGKYYAVNFPMRDGIDDESYGQ
IFKPIISKVMEMYQPSAVVLQCGADSLSGDRLGCFNLTVKGHAKCVEVVKTFNLPLLMLG
GGGYTIRNVARCWTYETAVALDCEIPNELPYNDYFEYFGPDFKLHISPSNMTNQNTPEYM
EKIKQRLFENLRMLPHAPGVQMQAIPEDAVHEDSGDEDGEDPDKRISIRASDKRIACDEE
FSDSEDEGEGGRRNVADHKKGAKKARIEEDKKETEDKKTDVKEEDKSKDNSGEKTDTKGA
KSEQLSNP
NT seq 1467 nt   +upstreamnt  +downstreamnt
atggcgtacagtcagggaggcggcaagaagaaagtctgttactactacgatggtgatatt
ggaaattattattacggacagggtcatcccatgaaacctcataggatccgcatgacccat
aacttgctgctaaattatggcttgtatagaaaaatggaaatatataggccccataaagcc
actgctgaagaaatgacaaaataccacagcgatgagtacatcaaatttctacgttcaata
agaccggataacatgtccgagtatagtaagcaaatgcagagatttaatgttggagaggat
tgtccagtgtttgatgggctctttgagttttgtcagctttcaactggtggttcagttgct
ggggctgtgaagttaaaccgacaacaaactgatatggctgttaactgggctggaggatta
catcatgctaagaaatcagaagcatcaggattctgttatgttaatgatattgtgcttgcc
atccttgaattactaaaatatcatcagagagtcttgtatattgatattgatatccatcat
ggtgatggtgttgaagaagctttttatacaacagatcgtgtaatgactgtatcattccat
aaatatggggaatactttcctggaacgggagacttgagggatattggtgcaggaaaaggc
aaatactatgctgtcaattttccaatgagagatggtatagacgatgaatcatatgggcag
atatttaagcctattatctcaaaagtgatggagatgtatcaacctagtgctgtggtgcta
cagtgtggtgcagactcactatccggtgatagacttggttgcttcaatttgacagtcaaa
ggtcatgctaaatgtgtagaagttgtaaaaactttcaatttaccattactgatgcttggg
ggaggtggatacacaatccgcaatgttgctcgatgttggacatatgagactgctgttgcc
cttgattgtgagattcccaatgaattgccatataatgattactttgagtattttggacca
gacttcaaactgcatattagtccttcaaacatgacaaaccagaacactccagaatatatg
gaaaagataaaacagcgtttatttgaaaatttacgcatgttaccacatgcacctggcgtc
caaatgcaagctattccagaagatgcagttcatgaagacagtggagatgaagatggagaa
gatccagacaagagaatttctattcgagcatcagacaaacggatagcttgtgatgaagaa
ttctcagattctgaggatgaaggagagggaggtcgtagaaatgtggctgatcataagaaa
ggagcaaagaaagctagaattgaagaagacaagaaggaaacggaggacaaaaaaacagat
gttaaagaagaagataaatccaaggacaatagtggtgaaaaaacagataccaaaggagcc
aaatcagaacagctcagcaatccttga

KEGG   Physeter catodon (sperm whale): 112062897
Entry
112062897         CDS       T06011                                 

Definition
(RefSeq) histone deacetylase 9-like
  KO
K06067  histone deacetylase 1/2 [EC:3.5.1.98]
Organism
pcad  Physeter catodon (sperm whale)
Pathway
pcad04110  Cell cycle
pcad04213  Longevity regulating pathway - multiple species
pcad04330  Notch signaling pathway
pcad04613  Neutrophil extracellular trap formation
pcad04919  Thyroid hormone signaling pathway
pcad05016  Huntington disease
pcad05031  Amphetamine addiction
pcad05034  Alcoholism
pcad05165  Human papillomavirus infection
pcad05169  Epstein-Barr virus infection
pcad05200  Pathways in cancer
pcad05202  Transcriptional misregulation in cancer
pcad05203  Viral carcinogenesis
pcad05206  MicroRNAs in cancer
pcad05220  Chronic myeloid leukemia
Brite
KEGG Orthology (KO) [BR:pcad00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04330 Notch signaling pathway
    112062897
 09140 Cellular Processes
  09143 Cell growth and death
   04110 Cell cycle
    112062897
 09150 Organismal Systems
  09151 Immune system
   04613  Neutrophil extracellular trap formation
    112062897
  09152 Endocrine system
   04919 Thyroid hormone signaling pathway
    112062897
  09149 Aging
   04213 Longevity regulating pathway - multiple species
    112062897
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    112062897
   05202 Transcriptional misregulation in cancer
    112062897
   05206 MicroRNAs in cancer
    112062897
   05203 Viral carcinogenesis
    112062897
  09162 Cancer: specific types
   05220 Chronic myeloid leukemia
    112062897
  09164 Neurodegenerative disease
   05016 Huntington disease
    112062897
  09165 Substance dependence
   05031 Amphetamine addiction
    112062897
   05034 Alcoholism
    112062897
  09172 Infectious disease: viral
   05169 Epstein-Barr virus infection
    112062897
   05165 Human papillomavirus infection
    112062897
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03036 Chromosome and associated proteins [BR:pcad03036]
    112062897
Enzymes [BR:pcad01000]
 3. Hydrolases
  3.5  Acting on carbon-nitrogen bonds, other than peptide bonds
   3.5.1  In linear amides
    3.5.1.98  histone deacetylase
     112062897
Chromosome and associated proteins [BR:pcad03036]
 Eukaryotic type
  Histone modification proteins
   HDACs (histone deacetylases)
    Class I HDACs
     112062897
   HDAC complexes
    Sin3A-HDAC complex
     112062897
    BRAF-HDAC complex
     112062897
  Heterochromatin formation proteins
   Other heterochromatin formation proteins
    112062897
  Chromatin remodeling factors
   NuRD complex
    112062897
SSDB
Motif
Pfam: Hist_deacetyl
Other DBs
NCBI-GeneID: 112062897
NCBI-ProteinID: XP_023973613
UniProt: A0A2Y9S4Y3
LinkDB
Position
1
AA seq 476 aa
MALSCLRKRVAYFYDPDIGSYYYGPGHPMKPQRIRMAHALVLSYDLYKHMEVYRPHKSIE
PELCLFHSSDYISFLSSVSPENYKEFSLQLKNFNVGEATDCPAFDGLFTFQQACAGASID
AAKKLNHHQADICINWSGGLHHAKRSEASGFCYINDIVLGILELLKYHARVMYVDIDIHH
GDGVEEAFYVSHRVLTVSFHKFGDFFPGTGDITDVGASQGKYYAVNVPLNDGMDDDSFVA
LFKPIITKCIEVYRPGAIVLQCGADSLTGDRLGKFNLSIKGHAACVQFVKSFDIPLMVLG
GGGYTIRNVARCWAYETGVVLDRHQEMSPQVPLNDYYDYYAPDFQLHLTPSCAPNQNSPD
HLEKIKTRVLSNLGYLEHAPGVQFAYVPPDFFGDDDEADDEDECAQLAVENDGGGRAPGT
VAAPTGPSTGPPPPPNTNSNKSTTNPPPPQPYRMRRKDYSNDFEDIPDRDQRKVPV
NT seq 1431 nt   +upstreamnt  +downstreamnt
atggcgctgagttgcctccgtaaacgggtcgcatacttttacgaccctgacatcgggagc
tactattatgggcccggacacccgatgaagccgcagcgaattcgtatggcccacgctctc
gttctttcttacgatctttataaacatatggaagtgtatagaccgcacaagtcgatcgag
ccggaactctgcctttttcactcgagcgactacatctccttcctgtcctctgtttctcct
gaaaattacaaagagttttctctgcagctgaagaatttcaacgtgggggaggctacggac
tgcccggccttcgatgggctcttcacatttcagcaggcatgcgcaggagcgtcaatcgac
gcggcgaagaagctgaaccaccaccaggcggacatttgcattaactggtcaggggggctg
caccacgcgaagcgatcagaggcctctgggttctgctacatcaacgacatcgtactgggc
atcttggagctgttgaaataccatgcacgcgtgatgtacgtggacatcgatattcaccat
ggagacggcgtggaggaggcattttacgtctcgcatcgtgtgttgactgtctccttccac
aagttcggagactttttcccaggcaccggcgacatcacagacgtgggagctagccagggc
aagtactacgcagtgaatgtgccgctgaatgacggcatggacgacgattccttcgttgca
ctcttcaaacctattatcacgaagtgtatcgaggtgtaccgtccaggggctatcgtgttg
cagtgtggcgccgatagcttgacaggagatcgccttggaaaattcaatctctctatcaaa
ggtcacgctgcatgtgtgcaattcgtgaagtcctttgatattccgttgatggtacttggc
ggcggtggttatactatacgcaatgtggctcgctgctgggcgtacgagacaggcgtcgtg
cttgatcgtcaccaggaaatgagtccgcaggtgcctttaaatgattattatgactactac
gcacctgacttccagcttcacctcacgccatcttgtgctcctaatcagaattcccccgac
catttagaaaaaatcaaaacacgggtgctttcgaatcttggctatttggaacacgcgcca
ggtgttcagtttgcctatgtcccacctgacttctttggtgatgatgatgaagctgatgac
gaagacgaatgtgcgcagctagccgtggaaaatgatggaggaggcagagcgcctggtacc
gttgctgctcctacgggtccctcgaccggccctccgccaccacccaacacaaacagcaac
aaaagcacgaccaacccgccacccccccagccctatcgtatgcggcgcaaagattactca
aatgattttgaagatattcccgacagagaccagcggaaggtgcctgtgtaa

DBGET integrated database retrieval system