KEGG   Physeter catodon (sperm whale): 102981762
Entry
102981762         CDS       T06011                                 

Gene name
EPO
Definition
(RefSeq) erythropoietin
  KO
K05437  erythropoietin
Organism
pcad  Physeter catodon (sperm whale)
Pathway
pcad04060  Cytokine-cytokine receptor interaction
pcad04066  HIF-1 signaling pathway
pcad04151  PI3K-Akt signaling pathway
pcad04630  JAK-STAT signaling pathway
pcad04640  Hematopoietic cell lineage
pcad05200  Pathways in cancer
Brite
KEGG Orthology (KO) [BR:pcad00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04630 JAK-STAT signaling pathway
    102981762 (EPO)
   04066 HIF-1 signaling pathway
    102981762 (EPO)
   04151 PI3K-Akt signaling pathway
    102981762 (EPO)
  09133 Signaling molecules and interaction
   04060 Cytokine-cytokine receptor interaction
    102981762 (EPO)
 09150 Organismal Systems
  09151 Immune system
   04640 Hematopoietic cell lineage
    102981762 (EPO)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    102981762 (EPO)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04052 Cytokines and growth factors [BR:pcad04052]
    102981762 (EPO)
Cytokines and growth factors [BR:pcad04052]
 Cytokines
  CSF and other factors
   102981762 (EPO)
SSDB
Motif
Pfam: EPO_TPO
Other DBs
NCBI-GeneID: 102981762
NCBI-ProteinID: XP_023979802
UniProt: A0A2Y9SQU8
LinkDB
Position
Unknown
AA seq 193 aa
MGVRECPALLLLLSSLLLPLGLPVLGAPPRLICDSRVLERYILEAREAENATMGCAEGCS
FSENITVPDTKVNFYAWKRMEVQQQAVEVWQGLALLSEAILQGQALLANSSQPSEALQLH
VDKAVSGLRSLTSLLRALGAQKGAVPLPDAASSAAPLRTFTVDTSCKLFRIYSNFLRGKL
TLYTGEACRRGDR
NT seq 582 nt   +upstreamnt  +downstreamnt
atgggggtgcgcgaatgtcctgccctgctgcttctgctgtcctcgctgctgcttcctctg
ggcctcccagtcctgggcgcccccccacgcctcatctgtgacagccgagtcctggagagg
tacatcctggaggccagggaggccgaaaatgccacgatgggctgtgctgaaggctgcagc
ttcagtgagaacatcactgtcccagacaccaaggttaacttctatgcctggaagaggatg
gaggtccagcagcaggctgtggaagtctggcagggcctggccctgctctcagaagccatc
ctgcagggccaggccctgttggccaactcgtcccagccatccgaggccctgcagctgcac
gtggacaaagctgtcagcggcctgcgaagcctcacctccctgcttcgggcgctgggagcc
cagaagggagccgtcccccttccagacgcagcctcctctgcagcccccctccgaacattc
actgttgatacttcgtgcaaacttttccgaatctactccaatttcctgcggggaaagctg
acgctgtacacaggggaggcctgccggagaggggacaggtga

DBGET integrated database retrieval system