KEGG   Physeter catodon (sperm whale): 102981902
Entry
102981902         CDS       T06011                                 

Gene name
CDKN1B
Definition
(RefSeq) cyclin-dependent kinase inhibitor 1B
  KO
K06624  cyclin-dependent kinase inhibitor 1B
Organism
pcad  Physeter catodon (sperm whale)
Pathway
pcad01522  Endocrine resistance
pcad04012  ErbB signaling pathway
pcad04066  HIF-1 signaling pathway
pcad04068  FoxO signaling pathway
pcad04110  Cell cycle
pcad04151  PI3K-Akt signaling pathway
pcad04933  AGE-RAGE signaling pathway in diabetic complications
pcad04934  Cushing syndrome
pcad05162  Measles
pcad05165  Human papillomavirus infection
pcad05169  Epstein-Barr virus infection
pcad05200  Pathways in cancer
pcad05202  Transcriptional misregulation in cancer
pcad05203  Viral carcinogenesis
pcad05206  MicroRNAs in cancer
pcad05215  Prostate cancer
pcad05220  Chronic myeloid leukemia
pcad05222  Small cell lung cancer
pcad05226  Gastric cancer
Brite
KEGG Orthology (KO) [BR:pcad00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04012 ErbB signaling pathway
    102981902 (CDKN1B)
   04066 HIF-1 signaling pathway
    102981902 (CDKN1B)
   04068 FoxO signaling pathway
    102981902 (CDKN1B)
   04151 PI3K-Akt signaling pathway
    102981902 (CDKN1B)
 09140 Cellular Processes
  09143 Cell growth and death
   04110 Cell cycle
    102981902 (CDKN1B)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    102981902 (CDKN1B)
   05202 Transcriptional misregulation in cancer
    102981902 (CDKN1B)
   05206 MicroRNAs in cancer
    102981902 (CDKN1B)
   05203 Viral carcinogenesis
    102981902 (CDKN1B)
  09162 Cancer: specific types
   05226 Gastric cancer
    102981902 (CDKN1B)
   05220 Chronic myeloid leukemia
    102981902 (CDKN1B)
   05215 Prostate cancer
    102981902 (CDKN1B)
   05222 Small cell lung cancer
    102981902 (CDKN1B)
  09167 Endocrine and metabolic disease
   04933 AGE-RAGE signaling pathway in diabetic complications
    102981902 (CDKN1B)
   04934 Cushing syndrome
    102981902 (CDKN1B)
  09172 Infectious disease: viral
   05162 Measles
    102981902 (CDKN1B)
   05169 Epstein-Barr virus infection
    102981902 (CDKN1B)
   05165 Human papillomavirus infection
    102981902 (CDKN1B)
  09176 Drug resistance: antineoplastic
   01522 Endocrine resistance
    102981902 (CDKN1B)
SSDB
Motif
Pfam: CDI
Other DBs
NCBI-GeneID: 102981902
NCBI-ProteinID: XP_007120646
UniProt: A0A2Y9T8E7
LinkDB
Position
Unknown
AA seq 198 aa
MSNVRVSNGSPSLERMDARQAEYPKPSACRNLFGPVNHEELTRDLEKHCRDMEEASQRKW
NFDFQNHKPLEGKYEWQEVEKGNLPEFYYRPPRPPKGACKVPAQEGQDVSGTRQAVPLIG
SQANSEDTHLVDQKTDAPDSQTGLAEQCTGIRKRPATDDSSPQNKRANRTEENVSDGSPN
AGSVEQTPKKPGLRRRQT
NT seq 597 nt   +upstreamnt  +downstreamnt
atgtcaaacgtgcgagtgtctaacgggagcccgagcctggagcggatggacgccagacag
gcggagtatcccaagccctcggcctgcagaaacctcttcggcccggtcaatcacgaagag
ttaacccgggacttggagaagcactgcagagacatggaagaggccagccagcgcaagtgg
aattttgattttcagaatcacaagcccctggagggcaaatacgagtggcaagaggtggaa
aagggcaacttgcccgagttctactacagacccccgcggccacccaaaggcgcctgcaag
gtgccggcgcaggagggccaggatgtcagcgggacccgccaggcggtgcctttaattggg
tctcaggcaaactcagaggacacgcatttggtagaccagaagactgatgcaccggacagc
cagacggggttagcggagcagtgcactgggataaggaagcgacctgccacagacgattcc
tctcctcaaaacaaaagagcaaacagaacagaagaaaatgtttcagacggttccccgaac
gcgggttcagtggagcagacgcccaagaagcccggcctcagaaggcgtcaaacgtaa

DBGET integrated database retrieval system