KEGG   Physeter catodon (sperm whale): 102982229
Entry
102982229         CDS       T06011                                 

Gene name
PTK2
Definition
(RefSeq) focal adhesion kinase 1 isoform X1
  KO
K05725  focal adhesion kinase 1 [EC:2.7.10.2]
Organism
pcad  Physeter catodon (sperm whale)
Pathway
pcad01522  Endocrine resistance
pcad04012  ErbB signaling pathway
pcad04062  Chemokine signaling pathway
pcad04151  PI3K-Akt signaling pathway
pcad04360  Axon guidance
pcad04370  VEGF signaling pathway
pcad04510  Focal adhesion
pcad04670  Leukocyte transendothelial migration
pcad04810  Regulation of actin cytoskeleton
pcad04935  Growth hormone synthesis, secretion and action
pcad05100  Bacterial invasion of epithelial cells
pcad05135  Yersinia infection
pcad05146  Amoebiasis
pcad05163  Human cytomegalovirus infection
pcad05165  Human papillomavirus infection
pcad05170  Human immunodeficiency virus 1 infection
pcad05200  Pathways in cancer
pcad05202  Transcriptional misregulation in cancer
pcad05205  Proteoglycans in cancer
pcad05222  Small cell lung cancer
pcad05418  Fluid shear stress and atherosclerosis
Brite
KEGG Orthology (KO) [BR:pcad00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04012 ErbB signaling pathway
    102982229 (PTK2)
   04370 VEGF signaling pathway
    102982229 (PTK2)
   04151 PI3K-Akt signaling pathway
    102982229 (PTK2)
 09140 Cellular Processes
  09144 Cellular community - eukaryotes
   04510 Focal adhesion
    102982229 (PTK2)
  09142 Cell motility
   04810 Regulation of actin cytoskeleton
    102982229 (PTK2)
 09150 Organismal Systems
  09151 Immune system
   04670 Leukocyte transendothelial migration
    102982229 (PTK2)
   04062 Chemokine signaling pathway
    102982229 (PTK2)
  09152 Endocrine system
   04935 Growth hormone synthesis, secretion and action
    102982229 (PTK2)
  09158 Development and regeneration
   04360 Axon guidance
    102982229 (PTK2)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    102982229 (PTK2)
   05202 Transcriptional misregulation in cancer
    102982229 (PTK2)
   05205 Proteoglycans in cancer
    102982229 (PTK2)
  09162 Cancer: specific types
   05222 Small cell lung cancer
    102982229 (PTK2)
  09166 Cardiovascular disease
   05418 Fluid shear stress and atherosclerosis
    102982229 (PTK2)
  09171 Infectious disease: bacterial
   05135 Yersinia infection
    102982229 (PTK2)
   05100 Bacterial invasion of epithelial cells
    102982229 (PTK2)
  09172 Infectious disease: viral
   05170 Human immunodeficiency virus 1 infection
    102982229 (PTK2)
   05163 Human cytomegalovirus infection
    102982229 (PTK2)
   05165 Human papillomavirus infection
    102982229 (PTK2)
  09174 Infectious disease: parasitic
   05146 Amoebiasis
    102982229 (PTK2)
  09176 Drug resistance: antineoplastic
   01522 Endocrine resistance
    102982229 (PTK2)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01001 Protein kinases [BR:pcad01001]
    102982229 (PTK2)
   01009 Protein phosphatases and associated proteins [BR:pcad01009]
    102982229 (PTK2)
Enzymes [BR:pcad01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.10  Protein-tyrosine kinases
    2.7.10.2  non-specific protein-tyrosine kinase
     102982229 (PTK2)
Protein kinases [BR:pcad01001]
 Non-receptor tyrosine kinases
  FAK family
   102982229 (PTK2)
Protein phosphatases and associated proteins [BR:pcad01009]
 Protein serine/threonine phosphatases
  Phosphoprotein phosphatases (PPPs)
   Protein phosphatase-1
    PP1-interacting proteins (PIPs)
     102982229 (PTK2)
SSDB
Motif
Pfam: PK_Tyr_Ser-Thr Focal_AT Pkinase FERM_N_2 FERM_M Kinase-like FERM_F2
Other DBs
NCBI-GeneID: 102982229
NCBI-ProteinID: XP_028356130
UniProt: A0A455C474
LinkDB
Position
15
AA seq 1132 aa
MFLLPAGNGARVEEHRADGAGAGRQEYDRYLASSKIMAAAYLDPNLNHTPNSSTKTHLGT
GVERSPGAMERVLKVFHYFESNSEPTTWASIIRHGDATDVRGIIQKIVDSHKVKHVACYG
FRLSHLRSEEVHWLHLDMGVSNVREKYELAHPPEEWKYELRIRYLPKGFLNQFTEDKPTL
NFFYQQVKSDYMLEIADQVDQDIALKLGCLEIRRSYWEMRGNALEKKSNYEVLEKDVGLK
RFFPRSLLDSVKAKTLRKLIQQTFRQFANLNREESILKFFEILSPVYRFDKECFKCALGS
SWIISVELAIGPEEGISYLTDKGCNPTHLADFNQVQTIQYSNSEDKDRKGTLQLKIAGAP
EPLTVTAPSLTIAENMADLIDGYCRLVHGATQSFIIRPQKEGERALPSIPKLANSEKQGV
RTHAVSVSGVSHCQHKVKKARRFLPLVFCSHEPPSADEISGDETDDYAEIIDEEDTYTMP
SKSYGIDEARDYEIQRERIELGRCIGEGQFGDVHQGAYTSPENPALAVAIKTCKNCTSDS
VREKFLQEALTMRQFDHPHIVKLIGVITENPVWIIMELCTLGELRSFLQVRKYSLDLASL
ILYAYQLSTALAYLESKRFVHRDIAARNVLVSSNDCVKLGDFGLSRYMEDSTYYKASKGK
LPIKWMAPESINFRRFTSASDVWMFGVCMWEILMHGVKPFQGVKNNDVIGRIENGERLPM
PPNCPPTLYSLMTKCWAYDPSRRPRFTELKAQLSTILEEEKVQQEERMRMESRRQVTVSW
DSGGSDEAPPKPSRPGYPSPRSSEGFHPSPQHMVQTNHYQVSGYPGSHGITAVAGSIYPG
QASLLDQTDSWNHRPQEISMWQPNVEDSATLDLRGIGQVLPTHLMEERLIRQQQEMEEDQ
RWLEKEERFLKPDVRLSRGSIDREDGGPQGPTGNQHIYQPVGKPDPAAPPKKPPRPGAPG
HLSSLASLGSPGDNYNEGVKPWRLQPQEISPPPTANLDRSNDRVYENVTGLVRAVIEMSS
KIQPAPPEEYVPMVKEVGLALRTLLATVDETIPVLPASTHREIEMAQKLLNSDLGELINK
MKLAQQYVMTSLQQEYKKQMLTAAHALAVDAKNLLDVIDQARLKALGQTRPH
NT seq 3399 nt   +upstreamnt  +downstreamnt
atgttcctcctgcctgctgggaacggtgcccgggttgaagaacatagggcagatggggca
ggagcagggagacaagaatatgacagatacctagcatctagcaaaataatggcagctgct
taccttgacccaaacttgaatcacacaccgaattcaagtaccaagactcacctgggtacc
ggtgtggaacgttcccctggggccatggagcgagtgttgaaggtctttcattattttgaa
agcaacagtgagccaaccacttgggccagtattatcaggcatggagatgctactgacgtc
aggggcatcattcagaagatagtggacagtcacaaagtaaagcacgtggcctgctatgga
tttcgcctcagtcacctgcggtcagaggaggttcactggctccatttggatatgggtgtc
tccaatgtgagggagaagtatgaacttgcacacccaccagaggagtggaaatacgaattg
agaattcgttatttgccaaaaggatttctaaaccagtttactgaagacaagccaactctg
aatttcttctatcaacaggtgaagagcgattatatgttggagatcgctgatcaagtggac
caggacattgctttgaagttgggttgtctagaaatacggcggtcgtactgggagatgcgg
ggcaacgccctggagaagaagtctaactatgaagtattagaaaaagatgttggtttgaag
cgattttttcctaggagtttactggattcagtcaaggccaaaacactaagaaaattgatc
caacaaacatttagacagtttgccaaccttaatagagaagaaagtattttgaaattcttt
gagatcctctccccagtgtacagatttgataaagaatgcttcaagtgtgcccttggttca
agctggattatttcggtggagctggcgattggccccgaagaaggaatcagttacctcaca
gacaagggctgcaaccccacacacctggccgacttcaatcaagtgcagaccattcagtat
tcaaacagcgaagacaaggacaggaaaggaacgctgcagctgaagattgcaggagcgcct
gagcctctgacggtgacagcaccgtccctgaccattgccgagaacatggccgacctgata
gatgggtactgccggctggtgcacggggccacgcagtctttcatcatcaggccccagaaa
gaaggtgaacgggctttgccatcgataccaaagctggccaacagcgagaagcagggcgtt
cggacccacgccgtctccgtgtcaggagtcagtcactgccaacataaagttaagaaagct
aggcgctttctccctttggtcttctgttcccacgaacctccttctgcggatgaaattagt
ggggacgaaacagatgactatgctgagattatcgacgaagaagatacctacaccatgccc
tcgaaaagctatggaatagatgaagccagggactatgagattcagagagaaagaatagaa
ctcggacggtgcatcggagagggccagtttggagacgtgcaccaaggcgcttacacgagc
ccggagaatccagctctggcggttgcaattaaaacatgtaaaaactgtacttcggacagc
gtgagagagaaattccttcaagaagccttaacgatgcgtcagtttgaccaccctcacatt
gtgaagctgattggagtcatcacagagaaccccgtctggatcatcatggagctgtgcacg
ctcggagagctgaggtcatttctgcaagtaaggaaatacagtttggatctagcatctctg
atcctctatgcctatcagcttagcacagcccttgcgtacctagagagcaaaagatttgtg
cacagggacattgctgctcggaatgttctggtgtcctcaaacgattgtgtaaaattagga
gactttggattatcccgatatatggaagacagtacttactacaaagcttccaaaggaaaa
ttgcctattaaatggatggctccagagtcaatcaattttcgccgttttacctcagctagt
gacgtatggatgtttggtgtgtgtatgtgggagatactgatgcacggtgtgaagcccttt
caaggtgtgaagaacaatgatgtgatcggtcgcattgagaacggggagaggttgcccatg
cctccgaactgccctcccactctctacagcctcatgaccaagtgctgggcctacgatccc
agccggcggccccgcttcactgagctcaaagctcagctcagcacaatcctggaggaagag
aaggtccagcaagaagaacggatgaggatggagtccagaaggcaggtcacagtgtcctgg
gactccggagggtccgacgaagcaccacccaagcccagcagacctggttatcctagtccg
aggtccagcgaagggtttcatcccagcccacagcacatggtacagaccaatcactaccag
gtctctggctaccctggctcacatggaatcacagccgtggctggcagcatctacccaggt
caggcatctcttttggaccaaacagattcgtggaatcacagaccacaggagatatcgatg
tggcagcccaacgtggaggactctgcaacactggacctgcgcggcatcgggcaggtgttg
ccgacccacctgatggaggagcggctgatccggcagcagcaggagatggaagaggatcag
cgctggctggagaaggaggagaggtttctgaaacctgacgtgcggctctctcgaggcagc
atcgacagggaggatggaggtcctcagggcccgactggaaaccagcacatatatcagcct
gtgggcaaaccagatcctgcagctccaccaaagaaaccaccgcgtcccggagccccgggg
cacctgagcagcctagccagcctcggcagccccggggacaattacaacgagggtgtcaag
ccgtggaggcttcagccccaggaaatcagcccccctcccactgccaacctggaccggtcc
aatgacagggtgtacgagaacgtgacgggcctggtgagggcggtcatcgagatgtccagc
aagatccagccagccccgccagaggagtatgtccccatggtgaaggaagtcggcttggcc
ctgaggacgctgttggccaccgtggatgagaccattcccgtcctgcccgccagcacccac
cgagagattgagatggcccagaagctgctgaactccgacctgggggagctcatcaacaag
atgaagctggcccagcagtatgtcatgaccagcctgcagcaggagtacaagaagcagatg
ctgacggctgcacacgccctggccgtggacgccaagaacctgcttgatgtcatcgaccag
gccagactgaaggccctggggcagacgaggccgcactga

DBGET integrated database retrieval system