KEGG   Physeter catodon (sperm whale): 102983230
Entry
102983230         CDS       T06011                                 

Gene name
PLCG2
Definition
(RefSeq) 1-phosphatidylinositol 4,5-bisphosphate phosphodiesterase gamma-2
  KO
K05859  phosphatidylinositol phospholipase C, gamma-2 [EC:3.1.4.11]
Organism
pcad  Physeter catodon (sperm whale)
Pathway
pcad00562  Inositol phosphate metabolism
pcad01100  Metabolic pathways
pcad01521  EGFR tyrosine kinase inhibitor resistance
pcad04012  ErbB signaling pathway
pcad04014  Ras signaling pathway
pcad04020  Calcium signaling pathway
pcad04062  Chemokine signaling pathway
pcad04064  NF-kappa B signaling pathway
pcad04066  HIF-1 signaling pathway
pcad04070  Phosphatidylinositol signaling system
pcad04072  Phospholipase D signaling pathway
pcad04360  Axon guidance
pcad04370  VEGF signaling pathway
pcad04380  Osteoclast differentiation
pcad04611  Platelet activation
pcad04613  Neutrophil extracellular trap formation
pcad04625  C-type lectin receptor signaling pathway
pcad04650  Natural killer cell mediated cytotoxicity
pcad04662  B cell receptor signaling pathway
pcad04664  Fc epsilon RI signaling pathway
pcad04666  Fc gamma R-mediated phagocytosis
pcad04670  Leukocyte transendothelial migration
pcad04722  Neurotrophin signaling pathway
pcad04750  Inflammatory mediator regulation of TRP channels
pcad04919  Thyroid hormone signaling pathway
pcad04933  AGE-RAGE signaling pathway in diabetic complications
pcad04935  Growth hormone synthesis, secretion and action
pcad05167  Kaposi sarcoma-associated herpesvirus infection
pcad05169  Epstein-Barr virus infection
pcad05170  Human immunodeficiency virus 1 infection
pcad05171  Coronavirus disease - COVID-19
pcad05200  Pathways in cancer
pcad05205  Proteoglycans in cancer
pcad05206  MicroRNAs in cancer
pcad05214  Glioma
pcad05223  Non-small cell lung cancer
pcad05225  Hepatocellular carcinoma
Module
pcad_M00130  Inositol phosphate metabolism, PI=> PIP2 => Ins(1,4,5)P3 => Ins(1,3,4,5)P4
Brite
KEGG Orthology (KO) [BR:pcad00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00562 Inositol phosphate metabolism
    102983230 (PLCG2)
 09130 Environmental Information Processing
  09132 Signal transduction
   04012 ErbB signaling pathway
    102983230 (PLCG2)
   04014 Ras signaling pathway
    102983230 (PLCG2)
   04370 VEGF signaling pathway
    102983230 (PLCG2)
   04064 NF-kappa B signaling pathway
    102983230 (PLCG2)
   04066 HIF-1 signaling pathway
    102983230 (PLCG2)
   04020 Calcium signaling pathway
    102983230 (PLCG2)
   04070 Phosphatidylinositol signaling system
    102983230 (PLCG2)
   04072 Phospholipase D signaling pathway
    102983230 (PLCG2)
 09150 Organismal Systems
  09151 Immune system
   04611 Platelet activation
    102983230 (PLCG2)
   04613 Neutrophil extracellular trap formation
    102983230 (PLCG2)
   04625 C-type lectin receptor signaling pathway
    102983230 (PLCG2)
   04650 Natural killer cell mediated cytotoxicity
    102983230 (PLCG2)
   04662 B cell receptor signaling pathway
    102983230 (PLCG2)
   04664 Fc epsilon RI signaling pathway
    102983230 (PLCG2)
   04666 Fc gamma R-mediated phagocytosis
    102983230 (PLCG2)
   04670 Leukocyte transendothelial migration
    102983230 (PLCG2)
   04062 Chemokine signaling pathway
    102983230 (PLCG2)
  09152 Endocrine system
   04935 Growth hormone synthesis, secretion and action
    102983230 (PLCG2)
   04919 Thyroid hormone signaling pathway
    102983230 (PLCG2)
  09156 Nervous system
   04722 Neurotrophin signaling pathway
    102983230 (PLCG2)
  09157 Sensory system
   04750 Inflammatory mediator regulation of TRP channels
    102983230 (PLCG2)
  09158 Development and regeneration
   04360 Axon guidance
    102983230 (PLCG2)
   04380 Osteoclast differentiation
    102983230 (PLCG2)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    102983230 (PLCG2)
   05206 MicroRNAs in cancer
    102983230 (PLCG2)
   05205 Proteoglycans in cancer
    102983230 (PLCG2)
  09162 Cancer: specific types
   05225 Hepatocellular carcinoma
    102983230 (PLCG2)
   05214 Glioma
    102983230 (PLCG2)
   05223 Non-small cell lung cancer
    102983230 (PLCG2)
  09167 Endocrine and metabolic disease
   04933 AGE-RAGE signaling pathway in diabetic complications
    102983230 (PLCG2)
  09172 Infectious disease: viral
   05170 Human immunodeficiency virus 1 infection
    102983230 (PLCG2)
   05171 Coronavirus disease - COVID-19
    102983230 (PLCG2)
   05167 Kaposi sarcoma-associated herpesvirus infection
    102983230 (PLCG2)
   05169 Epstein-Barr virus infection
    102983230 (PLCG2)
  09176 Drug resistance: antineoplastic
   01521 EGFR tyrosine kinase inhibitor resistance
    102983230 (PLCG2)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04131 Membrane trafficking [BR:pcad04131]
    102983230 (PLCG2)
Enzymes [BR:pcad01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.4  Phosphoric-diester hydrolases
    3.1.4.11  phosphoinositide phospholipase C
     102983230 (PLCG2)
Membrane trafficking [BR:pcad04131]
 Exocytosis
  Calcium ion-dependent exocytosis
   Phospholipases
    102983230 (PLCG2)
 Endocytosis
  Macropinocytosis
   Phospholipase C
    102983230 (PLCG2)
SSDB
Motif
Pfam: PI-PLC-X SH2 PI-PLC-Y C2 SH3_1 SH3_9 PH SH3_2 PH_12 PH_14 EF-hand_like
Other DBs
NCBI-GeneID: 102983230
NCBI-ProteinID: XP_023980747
UniProt: A0A2Y9STJ9
LinkDB
Position
17
AA seq 1265 aa
MSTAVNVDALPEYEKSQIKRALELGTVMTVFSFRKSTPERRTVQVIMETQQVAWSKTADK
IEGFLDIMEIKEIRPGKNSKDFERAKAVRQKEECCFTILYGTQFVLSTLSLAADSKEDAT
KWLSGLKILHQEVMSASTPTIIESWLRKQIYSVDQTRRNSISLRELKTILPLVNFKVSSA
KFLKDKFVEIGAHKDELSFEQFHLFYKKLMFEQQKLILDEFKKDSSVFILGNTDRPDASA
VHLHDFQRFLSHEQQELWAQDLNKVRERMTKFIDDTMRETAEPFLFVDEFLTYLFSRENS
IWDEKYDVVDVQEMNNPLSHYWISSSHNTYLTGDQLRSESSPEAYIRCLRMGCRCIELDC
WDGPDGKPIIYHGWTRTTKIKFDDVVQAIKDHAFVTSSFPVILSIEEHCCVEQQRHMARV
FREVFGDLLLTKPTEASADQLPSPSQLREKIIIKHKKLGPRGDVDVNMEDKKDEHKQQGE
LYMWDSIDQKWTRHYCAIADAKLSFSDDIEQTVEGEQPPDIAPTELHFGEKWFHKKVEKR
TSAEKLLQEYCAETGGKDGTFLVRESETYPNDYTLSFWRSGRVQHCRIRSTVEGGTLKYY
LTDNLMFTSIYALIQHYSETHLRCAEFELRLTDPVPNPSPHKSKPWYYDGLSRGEAEDML
MRVPRDGAFLIRKREGTDSYAITFRARGKVKHCRINRDGRHFVLGTSAYFESLVELVSYY
EKHALYRKMRLRYPVTPELLERYNMERDINSLYDVSRMYVDPSEINPSMPQRTVKALYDY
KAKQSDELSFCRGALIHNVSKEPGGWWKGDYGTRIQQYFPSNYVEDISTADGEELEKQII
EDNPLGSLCRGILDLNTYNVVKAPQGKNQKPFVFILEPKKQGDPPVEFATDKVEELFEWF
QSIREITWKIDTKENNMKYWEKNQSIAIELSDLVVYCKPTSKTKDNLENPDFREIRSFVE
TKADSVVRQKPNDLLKYNQKGLTRVYPKGQRVDSSNYDPFRLWLCGSQMVALNFQTPDKY
LQMNHALFSLNGRTGYVLQPESMRAEKYDPMPPEAQRKILMTLTVKVLGARHLPKPGRSI
ACPFVEVEICGAEYDNNKFKTTVVNDNGLSPVWAPTQEKVTFEIYDPNLAFLRFVVYEED
MFSDPNFLAHATFPIKGIKSGFRSVPLKNGYSEDLELASLLVFCEMRPVLESEEELYSSC
RQLRRRQEELNNQLFLYDTHQNLRNANRDALVREFNVNENQLQLYQEKCNRRLREKRVSN
SKFYS
NT seq 3798 nt   +upstreamnt  +downstreamnt
atgagcaccgcggtcaatgttgacgcccttccggagtacgagaagagtcagatcaagagg
gccctggagctgggcacggtgatgacagtgttcagcttccgcaagtccaccccggagcgg
aggaccgtccaggtgatcatggagacccagcaggtggcctggagcaagacggccgataag
atcgagggcttcctggatatcatggaaataaaggaaatccgcccagggaagaactccaag
gattttgagcgtgcgaaagcagtccgccagaaggaagagtgctgcttcaccatcttgtac
ggcacccagttcgtcctcagcacgctcagcttagcagccgactctaaagaagatgcaact
aagtggctctctggcttgaagatcttacaccaggaagtgatgagcgcatccacccccacc
atcattgagagttggttgagaaagcagatttattctgtggatcaaaccagaagaaacagc
atcagcctccgagagttgaagaccatcttgcccctggtcaacttcaaagtgagcagcgcc
aagttcctcaaagataagttcgtggaaataggcgcacacaaagatgaactcagctttgaa
cagttccatctcttctataaaaaacttatgtttgaacagcaaaaattgattcttgacgaa
ttcaaaaaggattcctccgtgttcatcttgggcaacaccgaccggccggatgcctccgct
gttcacctgcacgacttccagaggtttctctcacatgaacagcaggagctttgggctcag
gatctgaacaaagtccgtgagcggatgacaaagttcattgatgacaccatgcgagaaact
gccgagcccttcctgtttgtggatgagttcctcacgtacctgttttcccgggagaacagc
atttgggacgagaagtatgacgtggtggatgtgcaggaaatgaacaaccccttgtcgcat
tactggatctcctcatcacataacacgtacctcacgggtgaccagcttcggagcgagtcg
tccccggaggcctatatccgctgtctgcggatgggctgccgctgcattgagctggactgc
tgggacgggcccgacgggaagcccatcatctaccacggctggacgcggaccaccaagatc
aagtttgatgacgtcgtgcaggccatcaaagaccatgcctttgtcacctcgagcttcccc
gtgatcctgtccatcgaggagcactgctgcgtggagcagcagcgccacatggcccgggtg
ttcagggaggtgttcggcgacctgctgctgaccaagcccacggaggccagtgccgaccag
ctgccgtcgcccagccagctgcgggagaagatcatcatcaagcataagaagctgggcccc
cgaggcgacgtggatgtcaacatggaggacaagaaagatgaacacaagcagcagggtgaa
ctgtacatgtgggattccatcgaccagaaatggactcggcactactgtgccattgctgat
gccaagctgtccttcagcgatgacattgaacagactgtggaaggtgaacagcccccggat
atagcccccacggagctgcattttggggagaagtggttccacaagaaggtggagaagagg
acaagtgccgagaagctgctgcaggaatactgcgccgagacggggggcaaggatgggacc
ttcttggtgcgggagagcgagacctaccccaatgactacaccctgtccttctggcggtcg
ggccgcgtccagcactgccggatccgctccaccgtggagggcgggaccctgaagtattac
ctgactgacaacctcatgtttaccagcatctacgccctcatccagcactacagcgagacg
cacctgcgctgtgccgagttcgagctccggctcaccgacccagttcccaaccccagcccg
cacaagtcgaagccgtggtactacgatgggctgagccgtggagaagcggaggacatgctg
atgagggttccccgggatggcgccttcctgatccggaagcgggaaggtaccgactcctac
gccatcaccttcagggccaggggcaaggtgaagcactgtcgcatcaaccgggacggccgg
cacttcgtgctgggcacctccgcctacttcgagagcctcgtggagctggtcagctactac
gagaagcacgcactctaccggaagatgagactgcgctaccccgtgacccccgagctcctg
gagcggtacaacatggaaagagatataaactccctctatgacgtcagcaggatgtatgtg
gatcccagtgaaatcaatccttccatgcctcagagaaccgtgaaagctctgtatgactac
aaagccaagcaaagcgatgagctgagcttctgccgtggtgccctcatccacaacgtctcc
aaggagcctgggggctggtggaaaggagactacggaaccagaatccagcagtacttcccg
tccaattacgttgaagacatttcaacagctgatggagaggagctggaaaagcagattatt
gaagacaatcccttagggtctctttgcagaggaatactggatctcaacacctataatgtt
gtaaaagccccacaggggaagaaccagaaacctttcgtctttatcttggagcccaagaag
cagggtgaccctccggtggagtttgccacagacaaggtggaggagctgttcgagtggttc
cagagcatccgggagatcacctggaagatcgacaccaaggagaacaacatgaagtactgg
gagaagaaccagtccatcgccatcgagctctcggacctggtcgtctactgcaaaccgacc
agcaagaccaaggacaacctagaaaaccccgacttccgagaaatccgctccttcgtggag
acaaaggctgacagcgtcgtcagacagaaacccaacgatctcttgaaatacaatcaaaag
ggcctgacccgcgtttaccccaagggacagcgggtggactcctccaactacgaccccttc
cgcctctggctgtgtggctcccagatggtggcactcaatttccagactccagataagtac
ctgcagatgaatcacgccctgttttccctcaacgggcggactggctacgtcctgcagccc
gagagcatgagggcggagaagtacgaccccatgccgcccgaggcgcagaggaagatcctg
atgactctgacggtcaaggttctgggggctcgtcatctccccaaacctggacgaagtatc
gcatgtccctttgtggaggtggaaatatgcggagccgaatatgacaacaacaagttcaaa
acaacagttgtgaatgacaacggcctaagccctgtttgggctccgacacaggagaaggtg
acgtttgaaatttatgacccaaacctcgcgtttctgcgctttgtggtttacgaggaagat
atgttcagcgatcccaactttctcgcgcatgccactttccccattaaaggaatcaagtca
ggatttagatctgttcctctgaagaacggctacagtgaagacctggagctggcttccctc
ctggttttctgtgagatgcggccagtcctggagagcgaagaggagctttactcctcctgc
cgccagctgcggaggcggcaagaagagctgaacaaccagctctttctgtacgacacacac
cagaacctgcgcaacgccaaccgggacgccctggtcagagagttcaacgtcaacgagaac
cagctgcagctgtaccaggagaagtgcaaccgcaggttaagagagaagagagtcagcaac
agcaagttttactcatag

KEGG   Physeter catodon (sperm whale): 102992700
Entry
102992700         CDS       T06011                                 

Gene name
PLCG1
Definition
(RefSeq) 1-phosphatidylinositol 4,5-bisphosphate phosphodiesterase gamma-1
  KO
K01116  phosphatidylinositol phospholipase C, gamma-1 [EC:3.1.4.11]
Organism
pcad  Physeter catodon (sperm whale)
Pathway
pcad00562  Inositol phosphate metabolism
pcad01100  Metabolic pathways
pcad01521  EGFR tyrosine kinase inhibitor resistance
pcad04012  ErbB signaling pathway
pcad04014  Ras signaling pathway
pcad04015  Rap1 signaling pathway
pcad04020  Calcium signaling pathway
pcad04062  Chemokine signaling pathway
pcad04064  NF-kappa B signaling pathway
pcad04066  HIF-1 signaling pathway
pcad04070  Phosphatidylinositol signaling system
pcad04072  Phospholipase D signaling pathway
pcad04360  Axon guidance
pcad04370  VEGF signaling pathway
pcad04613  Neutrophil extracellular trap formation
pcad04650  Natural killer cell mediated cytotoxicity
pcad04658  Th1 and Th2 cell differentiation
pcad04659  Th17 cell differentiation
pcad04660  T cell receptor signaling pathway
pcad04664  Fc epsilon RI signaling pathway
pcad04666  Fc gamma R-mediated phagocytosis
pcad04670  Leukocyte transendothelial migration
pcad04722  Neurotrophin signaling pathway
pcad04750  Inflammatory mediator regulation of TRP channels
pcad04919  Thyroid hormone signaling pathway
pcad04933  AGE-RAGE signaling pathway in diabetic complications
pcad04935  Growth hormone synthesis, secretion and action
pcad05012  Parkinson disease
pcad05022  Pathways of neurodegeneration - multiple diseases
pcad05135  Yersinia infection
pcad05167  Kaposi sarcoma-associated herpesvirus infection
pcad05170  Human immunodeficiency virus 1 infection
pcad05171  Coronavirus disease - COVID-19
pcad05200  Pathways in cancer
pcad05205  Proteoglycans in cancer
pcad05206  MicroRNAs in cancer
pcad05214  Glioma
pcad05223  Non-small cell lung cancer
pcad05225  Hepatocellular carcinoma
pcad05231  Choline metabolism in cancer
pcad05235  PD-L1 expression and PD-1 checkpoint pathway in cancer
Module
pcad_M00130  Inositol phosphate metabolism, PI=> PIP2 => Ins(1,4,5)P3 => Ins(1,3,4,5)P4
Brite
KEGG Orthology (KO) [BR:pcad00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00562 Inositol phosphate metabolism
    102992700 (PLCG1)
 09130 Environmental Information Processing
  09132 Signal transduction
   04012 ErbB signaling pathway
    102992700 (PLCG1)
   04014 Ras signaling pathway
    102992700 (PLCG1)
   04015 Rap1 signaling pathway
    102992700 (PLCG1)
   04370 VEGF signaling pathway
    102992700 (PLCG1)
   04064 NF-kappa B signaling pathway
    102992700 (PLCG1)
   04066 HIF-1 signaling pathway
    102992700 (PLCG1)
   04020 Calcium signaling pathway
    102992700 (PLCG1)
   04070 Phosphatidylinositol signaling system
    102992700 (PLCG1)
   04072 Phospholipase D signaling pathway
    102992700 (PLCG1)
 09150 Organismal Systems
  09151 Immune system
   04613 Neutrophil extracellular trap formation
    102992700 (PLCG1)
   04650 Natural killer cell mediated cytotoxicity
    102992700 (PLCG1)
   04660 T cell receptor signaling pathway
    102992700 (PLCG1)
   04658 Th1 and Th2 cell differentiation
    102992700 (PLCG1)
   04659 Th17 cell differentiation
    102992700 (PLCG1)
   04664 Fc epsilon RI signaling pathway
    102992700 (PLCG1)
   04666 Fc gamma R-mediated phagocytosis
    102992700 (PLCG1)
   04670 Leukocyte transendothelial migration
    102992700 (PLCG1)
   04062 Chemokine signaling pathway
    102992700 (PLCG1)
  09152 Endocrine system
   04935 Growth hormone synthesis, secretion and action
    102992700 (PLCG1)
   04919 Thyroid hormone signaling pathway
    102992700 (PLCG1)
  09156 Nervous system
   04722 Neurotrophin signaling pathway
    102992700 (PLCG1)
  09157 Sensory system
   04750 Inflammatory mediator regulation of TRP channels
    102992700 (PLCG1)
  09158 Development and regeneration
   04360 Axon guidance
    102992700 (PLCG1)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    102992700 (PLCG1)
   05206 MicroRNAs in cancer
    102992700 (PLCG1)
   05205 Proteoglycans in cancer
    102992700 (PLCG1)
   05231 Choline metabolism in cancer
    102992700 (PLCG1)
   05235 PD-L1 expression and PD-1 checkpoint pathway in cancer
    102992700 (PLCG1)
  09162 Cancer: specific types
   05225 Hepatocellular carcinoma
    102992700 (PLCG1)
   05214 Glioma
    102992700 (PLCG1)
   05223 Non-small cell lung cancer
    102992700 (PLCG1)
  09164 Neurodegenerative disease
   05012 Parkinson disease
    102992700 (PLCG1)
   05022 Pathways of neurodegeneration - multiple diseases
    102992700 (PLCG1)
  09167 Endocrine and metabolic disease
   04933 AGE-RAGE signaling pathway in diabetic complications
    102992700 (PLCG1)
  09171 Infectious disease: bacterial
   05135 Yersinia infection
    102992700 (PLCG1)
  09172 Infectious disease: viral
   05170 Human immunodeficiency virus 1 infection
    102992700 (PLCG1)
   05171 Coronavirus disease - COVID-19
    102992700 (PLCG1)
   05167 Kaposi sarcoma-associated herpesvirus infection
    102992700 (PLCG1)
  09176 Drug resistance: antineoplastic
   01521 EGFR tyrosine kinase inhibitor resistance
    102992700 (PLCG1)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04131 Membrane trafficking [BR:pcad04131]
    102992700 (PLCG1)
Enzymes [BR:pcad01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.4  Phosphoric-diester hydrolases
    3.1.4.11  phosphoinositide phospholipase C
     102992700 (PLCG1)
Membrane trafficking [BR:pcad04131]
 Exocytosis
  Calcium ion-dependent exocytosis
   Phospholipases
    102992700 (PLCG1)
 Endocytosis
  Macropinocytosis
   Phospholipase C
    102992700 (PLCG1)
SSDB
Motif
Pfam: PI-PLC-X SH2 PI-PLC-Y SH3_1 C2 PH SH3_9 SH3_2 GDPD PH_12 PH_9
Other DBs
NCBI-GeneID: 102992700
NCBI-ProteinID: XP_028342587
UniProt: A0A455B1D6
LinkDB
Position
Unknown
AA seq 1255 aa
MGPHFSLPVDIREIKEIRPGKTSRDFDRYQEDPAFRPDQSHCFVILYGMEFRLKTLSLQA
TSEDEVNMWIKGLTWLMEDTLQAATPLQIERWLRKQFYSVDRNREDRWVLRCGSSPAGIS
AKDLKNMLSQVNYRVPNMRFLRERLTDLEQRTSDITYGQFAQLYRSLMYSAQKTVHEPPA
PTAPALLSHPSPACLSPAALLGGDWMDLPFLEASSLRAGERPELCRVSLPEFQQFLLEYQ
GELWAVDRLQVQEFMLSFLRDPLREIEEPYFFLDEFVTFLFSKENSIWNSQLDAVCPDTM
NNPLSHYWISSSHNTYLTGDQFSSESSLEAYARCLRMGCRCIELDCWDGPDGMPVIYHGH
TLTTKIKFSDVLHTIKEHAFVASEYPVILSIEDHCSIAQQRNMAQYFKKVLGDTLLTKPV
DIAADGLPSPSQLKRKILIKHKKLAEGSAYEEVPTSVMYSENDISNSIKNGILYLEDPVN
HEWYPHYFVLTSSKIYYSEETSSDQGNEDEEEPKEASGSTELHSNEKWFHGKLGAGRDGR
HIAERLLTEYCIETGAPDGSFLVRESETFVGDYTLSFWRNGKVQHCRIHSRQDAGTPKFF
LTDNLVFDSLYDLITHYQQVPLRCNEFEMRLSEPVPQTNAHESKEWYHASLTRAQAEHML
MRVPRDGAFLVRKRNEPNSYAISFRAEGKIKHCRVQQEGQTVMLGNSEFDSLVDLVSYYE
KHPLYRKMKLRYPINEEALEKIGTAEPDYGALYEGRNPGFYVEANPMPTFKCAVKALFDY
KAQREDELTFTKSAIIQNVEKQEGGWWRGDYGGKKQLWFPSNYVEEMVSPAALEPEREHL
DENSPLGDLLRGVLDVPACQIAIRPEGKNNRLFVFSISMASVAHWSLDVAADSQEELQDW
VKKIREVAQTADARLTEGKMMERRKKIALELSELVVYCRPVPFDEEKIGTERACYRDMSS
FPETKAEKYVNKAKGKKFLQYNRLQLSRIYPKGQRLDSSNYDPLPMWICGSQLVALNFQT
PDKPMQMNQALFLAGGHCGYVLQPSIMRDEAFDPFDKSSLRGLEPCAICIEVLGARHLPK
NGRGIVCPFVELEVAGAEYDSTKQKTEFVVDNGLNPMWPAKPFHFQISNPEFAFLRFVVY
EEDMFSDQNFLAQATFPVKGLKTGYRAVPLKNNYSEDLELASLLVKVDVYPAKQENGDLS
PFGGASLRERGCDASGQLFHGRAREGSFEARYQQPFEDFRISQEHLADHFDSRER
NT seq 3767 nt   +upstreamnt  +downstreamnt
atgggtccccatttctctttgccagttgacattcgagaaatcaaggagatccgccccggg
aagacctcacgggacttcgatcgctaccaagaggatcctgcttttcgaccggaccagtca
cactgctttgtcatcctgtatggaatggaattccgcctgaagaccctgagcctgcaagct
acgtctgaggacgaagtgaacatgtggatcaagggcctgacttggctgatggaggatacg
ttgcaggcggccacacccttgcagattgagaggtggctgcggaagcagttttactcagtg
gaccggaatcgtgaggatcggtgggtcctgcgctgtggctctagcccagcaggtatatca
gccaaggacctgaagaacatgctgtcccaggtcaactaccgggtccccaacatgcgcttc
ctccgagagcggctgacggacctggagcagcgcaccagcgatatcacctacgggcagttt
gctcagctgtaccgcagcctcatgtacagcgcccagaagacggtgcatgagccacctgcc
cccaccgcccctgccctgctctcccaccctagccccgcttgcctcagccctgctgccctg
cttgggggcgattggatggacctccccttcctggaagccagttccctgagggcgggggag
cggccggagctctgccgggtgtcccttcctgagttccagcagttcctcctcgagtaccag
ggggagctgtgggctgtcgaccggctccaggtgcaggagttcatgctcagcttcctccga
gaccccttgcgagagattgaggaaccttacttcttcctggacgagttcgtcaccttcctg
ttctccaaggagaacagcatatggaactcgcagctggacgccgtgtgccccgacaccatg
aacaaccccctgtcccactactggatctcctcctcgcacaacacatacctgaccggggac
cagttttccagcgagtcctccctggaagcctacgcccgctgcttgcggatgggctgccgc
tgcattgagttggactgctgggacggtccagacgggatgccagtcatttaccacggacac
accctgaccaccaagatcaagttctcagacgtcctgcacaccatcaaggagcacgccttt
gtggcctcagagtacccggtcatcttgtccatcgaggaccattgcagcatcgcccagcag
aggaacatggcccagtacttcaagaaggtgctcggggacacactcctcaccaagcccgtg
gacatcgctgctgacgggctcccctcacccagccagctcaagaggaagatcctcatcaag
cacaagaagctggctgagggcagtgcctatgaagaggtgcctacatccgtgatgtactct
gagaacgacatcagcaactccatcaagaatggtatcctctacctggaggaccccgtgaat
cacgagtggtatccccactacttcgttctgaccagtagcaagatctactactccgaggag
accagcagtgaccagggcaacgaggatgaggaggagcccaaggaggccagtggcagcaca
gagctgcactccaacgagaagtggtttcacgggaagctcggggcgggacgggacgggcgg
cacatcgccgagcgcctgctcacggagtactgcatcgagaccggggcccccgacggctcc
ttcctcgtgcgcgagagcgagaccttcgtgggcgactacaccctctccttctggcggaac
ggcaaagtccagcactgccggatccactcccggcaggacgcagggacccccaagttcttc
ctgacagacaacctcgtcttcgactcactctatgacctcatcacacactaccagcaggtg
cccctgcgctgcaacgaatttgagatgcgcctctcagagcccgtcccgcagaccaacgcc
catgagagcaaagagtggtaccacgcgagcctgaccagagcgcaggccgagcacatgctg
atgcgcgtcccccgggacggggccttcctggtgcggaaacggaatgagcccaactcctac
gccatctccttccgggctgagggcaagatcaagcactgccgcgtccagcaggagggccag
accgtgatgctgggcaactcagagtttgacagcctcgtggacctcgtcagctactacgag
aagcaccccctgtaccgcaagatgaagctacgctatcccatcaacgaggaggcgctggag
aagatcggcacagcggagcccgactacggggccctgtatgagggccgcaaccccggcttc
tacgtggaggcgaaccccatgccgactttcaagtgcgccgtcaaagctctcttcgactac
aaggcccagagagaggacgagctgactttcaccaagagcgccatcatccagaacgtggag
aagcaggaaggaggctggtggcgtggtgactatggtgggaagaagcagctgtggttcccg
tcgaactacgtggaagagatggtcagccctgcggccctggagcctgagagggagcacttg
gacgagaacagccccctgggggacttgctgcggggggtcttggatgtgccggcttgtcag
atagccatccgtcctgagggcaagaacaaccggctcttcgtcttctccatcagcatggcg
tcggtggcacactggtccctagatgtggctgccgactcacaggaggagctgcaggactgg
gtgaaaaagatccgggaagtggcccagaccgcggatgccaggctcactgaggggaagatg
atggagcggaggaagaagatcgccctggagctctccgagcttgtcgtctactgccggcct
gttcccttcgacgaagagaagatcggcacagaacgcgcctgctaccgggacatgtcatcc
ttcccggaaaccaaggctgagaagtacgtgaacaaggccaaaggcaaaaagttcctccag
tacaaccggctgcagctctcccgcatctaccccaagggccagcggctggactcctccaat
tacgaccccttgcccatgtggatctgtggcagtcagctggtggccctcaacttccagacc
ccagacaagcctatgcagatgaaccaggccctcttcctggccggcgggcactgtggctac
gtgctgcagccgagcatcatgcgcgatgaggccttcgacccctttgacaagagcagcctc
cgcgggctggagccgtgtgccatctgcatcgaggtgctgggggcccggcatctgccgaag
aatggccgaggtatcgtgtgtcctttcgtggagcttgaggtggccggtgctgagtatgac
agcaccaagcagaagacggagtttgtggtggacaatggactgaaccccatgtggccagcc
aagcccttccacttccagatcagtaaccccgaattcgccttcctgcgctttgtggtgtat
gaggaagacatgtttagtgaccagaacttcctggctcaggctaccttccctgtgaagggc
ctgaagacaggatacagagcagtgcctttgaagaacaactatagcgaggacctggagttg
gcctccctgctcgtcaaggtcgacgtttaccctgccaagcaggagaacggtgacctcagt
ccctttgggggtgcgtccctgcgggagcggggctgcgacgcctcgggccagctgtttcat
ggccgggcccgggaaggctccttcgaagctcgctaccagcagccgtttgaggacttccgc
atttcccaggagcatctcgccgaccattttgacagtcgggaacgaag

DBGET integrated database retrieval system