KEGG   Physeter catodon (sperm whale): 102983319Help
Entry
102983319         CDS       T06011                                 

Gene name
ADCY5
Definition
(RefSeq) adenylate cyclase type 5
  KO
K08045  adenylate cyclase 5 [EC:4.6.1.1]
Organism
pcad  Physeter catodon (sperm whale)
Pathway
pcad00230  Purine metabolism
pcad01100  Metabolic pathways
pcad01522  Endocrine resistance
pcad04015  Rap1 signaling pathway
pcad04022  cGMP-PKG signaling pathway
pcad04024  cAMP signaling pathway
pcad04062  Chemokine signaling pathway
pcad04072  Phospholipase D signaling pathway
pcad04114  Oocyte meiosis
pcad04211  Longevity regulating pathway
pcad04213  Longevity regulating pathway - multiple species
pcad04261  Adrenergic signaling in cardiomyocytes
pcad04270  Vascular smooth muscle contraction
pcad04371  Apelin signaling pathway
pcad04540  Gap junction
pcad04611  Platelet activation
pcad04713  Circadian entrainment
pcad04714  Thermogenesis
pcad04723  Retrograde endocannabinoid signaling
pcad04724  Glutamatergic synapse
pcad04725  Cholinergic synapse
pcad04726  Serotonergic synapse
pcad04727  GABAergic synapse
pcad04728  Dopaminergic synapse
pcad04750  Inflammatory mediator regulation of TRP channels
pcad04911  Insulin secretion
pcad04912  GnRH signaling pathway
pcad04913  Ovarian steroidogenesis
pcad04914  Progesterone-mediated oocyte maturation
pcad04915  Estrogen signaling pathway
pcad04916  Melanogenesis
pcad04918  Thyroid hormone synthesis
pcad04921  Oxytocin signaling pathway
pcad04923  Regulation of lipolysis in adipocytes
pcad04924  Renin secretion
pcad04925  Aldosterone synthesis and secretion
pcad04926  Relaxin signaling pathway
pcad04927  Cortisol synthesis and secretion
pcad04928  Parathyroid hormone synthesis, secretion and action
pcad04934  Cushing syndrome
pcad04935  Growth hormone synthesis, secretion and action
pcad04970  Salivary secretion
pcad04971  Gastric acid secretion
pcad04972  Pancreatic secretion
pcad04976  Bile secretion
pcad05012  Parkinson disease
pcad05030  Cocaine addiction
pcad05031  Amphetamine addiction
pcad05032  Morphine addiction
pcad05034  Alcoholism
pcad05163  Human cytomegalovirus infection
pcad05166  Human T-cell leukemia virus 1 infection
pcad05200  Pathways in cancer
pcad05414  Dilated cardiomyopathy (DCM)
Brite
KEGG Orthology (KO) [BR:pcad00001]
 09100 Metabolism
  09104 Nucleotide metabolism
   00230 Purine metabolism
    102983319 (ADCY5)
 09130 Environmental Information Processing
  09132 Signal transduction
   04015 Rap1 signaling pathway
    102983319 (ADCY5)
   04371 Apelin signaling pathway
    102983319 (ADCY5)
   04072 Phospholipase D signaling pathway
    102983319 (ADCY5)
   04024 cAMP signaling pathway
    102983319 (ADCY5)
   04022 cGMP-PKG signaling pathway
    102983319 (ADCY5)
 09140 Cellular Processes
  09143 Cell growth and death
   04114 Oocyte meiosis
    102983319 (ADCY5)
  09144 Cellular community - eukaryotes
   04540 Gap junction
    102983319 (ADCY5)
 09150 Organismal Systems
  09151 Immune system
   04611 Platelet activation
    102983319 (ADCY5)
   04062 Chemokine signaling pathway
    102983319 (ADCY5)
  09152 Endocrine system
   04911 Insulin secretion
    102983319 (ADCY5)
   04923 Regulation of lipolysis in adipocytes
    102983319 (ADCY5)
   04912 GnRH signaling pathway
    102983319 (ADCY5)
   04913 Ovarian steroidogenesis
    102983319 (ADCY5)
   04915 Estrogen signaling pathway
    102983319 (ADCY5)
   04914 Progesterone-mediated oocyte maturation
    102983319 (ADCY5)
   04921 Oxytocin signaling pathway
    102983319 (ADCY5)
   04926 Relaxin signaling pathway
    102983319 (ADCY5)
   04935 Growth hormone synthesis, secretion and action
    102983319 (ADCY5)
   04918 Thyroid hormone synthesis
    102983319 (ADCY5)
   04928 Parathyroid hormone synthesis, secretion and action
    102983319 (ADCY5)
   04916 Melanogenesis
    102983319 (ADCY5)
   04924 Renin secretion
    102983319 (ADCY5)
   04925 Aldosterone synthesis and secretion
    102983319 (ADCY5)
   04927 Cortisol synthesis and secretion
    102983319 (ADCY5)
  09153 Circulatory system
   04261 Adrenergic signaling in cardiomyocytes
    102983319 (ADCY5)
   04270 Vascular smooth muscle contraction
    102983319 (ADCY5)
  09154 Digestive system
   04970 Salivary secretion
    102983319 (ADCY5)
   04971 Gastric acid secretion
    102983319 (ADCY5)
   04972 Pancreatic secretion
    102983319 (ADCY5)
   04976 Bile secretion
    102983319 (ADCY5)
  09156 Nervous system
   04724 Glutamatergic synapse
    102983319 (ADCY5)
   04727 GABAergic synapse
    102983319 (ADCY5)
   04725 Cholinergic synapse
    102983319 (ADCY5)
   04728 Dopaminergic synapse
    102983319 (ADCY5)
   04726 Serotonergic synapse
    102983319 (ADCY5)
   04723 Retrograde endocannabinoid signaling
    102983319 (ADCY5)
  09157 Sensory system
   04750 Inflammatory mediator regulation of TRP channels
    102983319 (ADCY5)
  09149 Aging
   04211 Longevity regulating pathway
    102983319 (ADCY5)
   04213 Longevity regulating pathway - multiple species
    102983319 (ADCY5)
  09159 Environmental adaptation
   04713 Circadian entrainment
    102983319 (ADCY5)
   04714 Thermogenesis
    102983319 (ADCY5)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    102983319 (ADCY5)
  09164 Neurodegenerative disease
   05012 Parkinson disease
    102983319 (ADCY5)
  09165 Substance dependence
   05030 Cocaine addiction
    102983319 (ADCY5)
   05031 Amphetamine addiction
    102983319 (ADCY5)
   05032 Morphine addiction
    102983319 (ADCY5)
   05034 Alcoholism
    102983319 (ADCY5)
  09166 Cardiovascular disease
   05414 Dilated cardiomyopathy (DCM)
    102983319 (ADCY5)
  09167 Endocrine and metabolic disease
   04934 Cushing syndrome
    102983319 (ADCY5)
  09172 Infectious disease: viral
   05166 Human T-cell leukemia virus 1 infection
    102983319 (ADCY5)
   05163 Human cytomegalovirus infection
    102983319 (ADCY5)
  09176 Drug resistance: antineoplastic
   01522 Endocrine resistance
    102983319 (ADCY5)
Enzymes [BR:pcad01000]
 4. Lyases
  4.6  Phosphorus-oxygen lyases
   4.6.1  Phosphorus-oxygen lyases (only sub-subclass identified to date)
    4.6.1.1  adenylate cyclase
     102983319 (ADCY5)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: AC_N Guanylate_cyc DUF1053 HNOBA TBK1_ULD PEN-2 DUF2339
Motif
Other DBs
NCBI-GeneID: 102983319
NCBI-ProteinID: XP_007106323
UniProt: A0A2Y9EQC1
LinkDB All DBs
Position
1
AA seq 1260 aa AA seqDB search
MSSSKSVSPPGYAAQTAAAPASRGGPEHRSAWGEADSRANGYPHAPGGSARGSTKKPGGT
VTPQQQQQRLASRWRSDDDDDPPLSGDDPLAGGFGFSFRSKSAWQERGGDDCGRGSRRQR
RGAAGGGSTRAPPAGGGGGSAAAAAAAGGTEVRPRSVELGLEERRGKGRAADELEAGAVE
EDQGSGDGGSLAGSGAGPGAVLSLGACCLALLQIFRSKKFPSDKLERLYQRYFFRLNQSS
LTMLMAVLVLVCLVMLAFHAARPPLQLPYLAVLTAAVGVILVMAVLCNRAAFHQDHMGLA
CYALIAVVLAVQVVGLLLPQPRSASEGIWWTVFFIYTIYTLLPVRMRAAVLSGVLLSALH
LAIALRTNAQDQFLLKQLVSNVLIFSCTNIVGVCTHYPAEVSQRQAFQETRECIQARLHS
QRENQQQERLLLSVLPRHVAMEMKADINAKQEDMMFHKIYIQKHDNVSILFADIEGFTSL
ASQCTAQELVMTLNELFARFDKLAAENHCLRIKILGDCYYCVSGLPEARADHAHCCVEMG
MDMIEAISLVREVTGVNVNMRVGIHSGRVHCGVLGLRKWQFDVWSNDVTLANHMEAGGKA
GRIHITKATLNYLNGDYEVEPGGGGERNAYLKEHSIETFLILRCTQKRKEEKAMIAKMNR
QRTNSIGHNPPHWGAERPFYNHLGGNQVSKEMKRMGFEDPKDKNAQESANPEDEVDEFLG
RAIDARSIDRLRSEHVRKFLLTFREPDLEKKYSKQVDDRFGAYVACASLVFLFICFVQIT
IVPHSVFMLSFYLTCFLLLTLVVFVSVIYSCVKLFPAPLQRLSRKIVRSKMNSTLVGVFT
ITLVFLSAFVNMFTCNSKDLFGCLADEHNISASEVNACHVVESDGNYSLGDERGFCGSPW
PNCNFPEYFTYSVLLSLLACSVFLQISCIGKLVLMLAIELIYVLVVEVPGVTLFDNADLL
VTANAIDFNNNGTSQCPEHATKVALKVVTPIIISVFVLALYLHAQQVESTARLDFLWKLQ
ATEEKEEMEELQAYNRRLLHNILPKDVAAHFLARERRNDELYYQSCECVAVMFASIANFS
EFYVELEANNEGVECLRLLNEIIADFDEIISEDRFRQLEKIKTIGSTYMAASGLNDSTYD
KVGKTHIKALADFAMKLMDQMKYINEHSFNNFQMKIGLNIGPVVAGVIGARKPQYDIWGN
TVNVASRMDSTGVPDRIQVTTDMYQVLAANTYQLECRGVVKVKGKGEMMTYFLNGGPPPS
NT seq 3783 nt NT seq  +upstreamnt  +downstreamnt
atgtccagctccaaaagcgtgagccccccgggctacgcggcgcagacagcggcggcgccg
gcgtcccggggaggcccggaacaccgctcggcgtggggcgaggccgactcccgcgccaat
ggctacccccacgcccccgggggttcggcccgcggctccaccaagaaacccggggggacg
gtgaccccgcagcagcagcagcagcgcctggccagccgctggcgcagcgacgacgacgac
gatcctccgctgagtggcgatgaccccctggctgggggcttcggcttcagtttccgttcc
aagtcggcctggcaggagcgcggcggcgacgactgcggtcgcggcagccggcggcagcgg
cggggcgcggccggcgggggcagcacccgagcgccccctgcgggcggcggcggcggctcg
gcggcggcggcggccgcagctggcgggacggaggtgcgcccccgttctgtggagctgggt
ctggaggagcggcggggcaagggccgcgcggccgacgagctggaggccggcgccgtcgag
gaagaccagggctccggagatggcggcagcttggcaggctcgggcgcggggcctggcgcg
gtgctgtcgctgggcgcctgctgcctggcactgctgcagatattccgctcgaagaagttc
ccgtcggacaagctggagcggctgtaccagcgctacttcttccgtctgaaccagagcagc
ctcactatgctcatggctgtgctggtgctcgtgtgcctcgtcatgttggccttccacgcg
gcacggcccccgctgcagctgccctacctggccgtgctgacggctgccgtgggtgtgatc
ctcgtcatggccgtgctctgcaaccgcgccgccttccaccaggaccacatgggcctggcc
tgctacgcgctcatcgccgtggtgctggctgtccaggtggtgggcctgctgctgccccag
ccgcgcagcgcctccgagggcatctggtggactgtgttcttcatctatactatctacacg
ctgctgcccgtgcgcatgcgggccgcggtactcagcggggtgctcctgtctgccctccac
ctggccatcgccctgcgcaccaacgcccaggaccagttcctgctcaagcagctcgtctcc
aacgtcctcattttctcctgcaccaacatcgtgggcgtctgcacccactacccggctgag
gtctcccagagacaggccttccaggagacccgggagtgcatccaggctcggctgcactcg
cagcgggagaaccagcagcaggagcggcttctgctgtctgtccttccccgtcacgttgcc
atggagatgaaagcagacatcaatgccaaacaggaggatatgatgttccataaaatttac
atccagaaacatgacaacgtgagcatcctgtttgctgacatcgagggcttcaccagcctg
gcgtcccagtgcaccgcccaggagcttgtcatgaccctcaacgagctcttcgcccgcttc
gacaagctggctgcagagaatcactgtttacgtattaagatcctgggagattgttattac
tgcgtctcagggctgcctgaagccagggctgaccatgcccactgctgcgtggagatgggc
atggacatgattgaggccatctcgctggtccgggaggtgacaggtgtcaacgtgaacatg
cgtgtgggaatccacagcgggcgagtgcactgtggcgtccttggcctcaggaagtggcag
ttcgacgtctggtctaacgacgtcacgctggccaaccacatggaggctggaggcaaggcg
ggacgcatccacatcaccaaggccacgctcaactacctgaatggcgactacgaagtggag
ccgggcggtgggggcgagcgcaacgcctacctcaaagagcacagtatcgagaccttcctc
atcctgcgctgcacccagaagcggaaagaagagaaggccatgattgccaagatgaatcgc
cagagaaccaactcgatcgggcacaacccaccacactggggggccgagcgccccttctac
aaccacctgggtggcaaccaggtgtccaaggagatgaaacggatgggctttgaagatccc
aaggacaagaacgcccaggaaagtgcgaaccccgaggatgaagtggatgaatttctgggc
cgtgccattgacgccaggagcatcgacaggctacgatctgagcatgttcgcaagttcctc
ttgaccttcagggagcctgacttagagaagaagtactccaagcaggtggatgaccgattc
ggtgcctacgtggcatgtgcctcgctcgtcttcctcttcatctgctttgtccagatcacc
attgtgccccactccgtgttcatgttgagtttctacctgacctgtttcctgctgctgacc
ttggtggtatttgtgtccgtgatctactcctgcgtgaagctcttcccggccccgctgcag
aggctatccaggaagatcgtgcggtccaagatgaacagcaccctggtgggcgtgttcacc
atcaccctggtgttcctgtcagcttttgtcaacatgttcacgtgcaactccaaggacctg
tttggctgcctggcggacgagcacaacatcagcgccagcgaggtcaacgcatgccacgtg
gtggagtcagatggcaactacagcctgggtgacgagcggggcttctgcggcagcccctgg
cccaactgcaacttccccgagtacttcacctatagcgtgctgctcagcctgctggcctgc
tccgtgttcctgcagatcagctgcatcgggaagctggtgctcatgctggccatcgagctc
atctacgtgcttgtcgttgaggtgcccggtgtcacgctctttgacaatgccgacctactg
gtcacagccaacgccatagacttcaacaacaacgggacctcccagtgccctgagcacgcg
accaaggtggcgctgaaggtggtgacgcccatcattatctcggtctttgtgctggccctg
tacctgcacgcccagcaggtggagtccaccgcccgccttgacttcctctggaaactgcag
gccactgaggagaaggaggagatggaggagctgcaggcctacaaccggcggctgctgcac
aacatcctgcccaaggatgtagccgcacacttcctggcccgcgagcggcgcaatgatgag
ctctactatcagtcgtgtgagtgcgtggctgtcatgttcgcctccatcgccaacttctcc
gagttctacgtggagctggaggccaacaacgagggcgtcgagtgcctgcggctgctcaac
gagatcatcgccgactttgacgagatcatcagtgaggatcggttcaggcagctggaaaag
atcaagaccatcggcagcacctacatggccgcctcgggcctcaacgactccacctatgac
aaggtgggcaagactcacatcaaagctctggctgacttcgccatgaagctgatggaccaa
atgaagtacatcaatgagcactccttcaacaacttccagatgaagattgggctcaatatc
ggccccgtagtggctggggtgattggggcccgcaaacctcagtacgacatctggggcaat
acagtgaacgtggccagccgcatggacagcaccggggtgcccgaccgcatccaggtcacc
acagacatgtaccaggtgctggccgccaacacgtaccagctggagtgccggggtgtggtc
aaggtcaagggcaaaggcgagatgatgacatacttcctcaacggagggcccccgcccagt
tag

DBGET integrated database retrieval system