KEGG   Physeter catodon (sperm whale): 102983478
Entry
102983478         CDS       T06011                                 

Gene name
EP300
Definition
(RefSeq) histone acetyltransferase p300 isoform X1
  KO
K04498  E1A/CREB-binding protein [EC:2.3.1.48]
Organism
pcad  Physeter catodon (sperm whale)
Pathway
pcad04024  cAMP signaling pathway
pcad04066  HIF-1 signaling pathway
pcad04068  FoxO signaling pathway
pcad04110  Cell cycle
pcad04310  Wnt signaling pathway
pcad04330  Notch signaling pathway
pcad04350  TGF-beta signaling pathway
pcad04520  Adherens junction
pcad04630  JAK-STAT signaling pathway
pcad04720  Long-term potentiation
pcad04916  Melanogenesis
pcad04919  Thyroid hormone signaling pathway
pcad04922  Glucagon signaling pathway
pcad04935  Growth hormone synthesis, secretion and action
pcad05016  Huntington disease
pcad05152  Tuberculosis
pcad05161  Hepatitis B
pcad05164  Influenza A
pcad05165  Human papillomavirus infection
pcad05166  Human T-cell leukemia virus 1 infection
pcad05167  Kaposi sarcoma-associated herpesvirus infection
pcad05200  Pathways in cancer
pcad05203  Viral carcinogenesis
pcad05206  MicroRNAs in cancer
pcad05211  Renal cell carcinoma
pcad05215  Prostate cancer
Brite
KEGG Orthology (KO) [BR:pcad00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04310 Wnt signaling pathway
    102983478 (EP300)
   04330 Notch signaling pathway
    102983478 (EP300)
   04350 TGF-beta signaling pathway
    102983478 (EP300)
   04630 JAK-STAT signaling pathway
    102983478 (EP300)
   04066 HIF-1 signaling pathway
    102983478 (EP300)
   04068 FoxO signaling pathway
    102983478 (EP300)
   04024 cAMP signaling pathway
    102983478 (EP300)
 09140 Cellular Processes
  09143 Cell growth and death
   04110 Cell cycle
    102983478 (EP300)
  09144 Cellular community - eukaryotes
   04520 Adherens junction
    102983478 (EP300)
 09150 Organismal Systems
  09152 Endocrine system
   04922 Glucagon signaling pathway
    102983478 (EP300)
   04935 Growth hormone synthesis, secretion and action
    102983478 (EP300)
   04919 Thyroid hormone signaling pathway
    102983478 (EP300)
   04916 Melanogenesis
    102983478 (EP300)
  09156 Nervous system
   04720 Long-term potentiation
    102983478 (EP300)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    102983478 (EP300)
   05206 MicroRNAs in cancer
    102983478 (EP300)
   05203 Viral carcinogenesis
    102983478 (EP300)
  09162 Cancer: specific types
   05211 Renal cell carcinoma
    102983478 (EP300)
   05215 Prostate cancer
    102983478 (EP300)
  09164 Neurodegenerative disease
   05016 Huntington disease
    102983478 (EP300)
  09171 Infectious disease: bacterial
   05152 Tuberculosis
    102983478 (EP300)
  09172 Infectious disease: viral
   05166 Human T-cell leukemia virus 1 infection
    102983478 (EP300)
   05161 Hepatitis B
    102983478 (EP300)
   05164 Influenza A
    102983478 (EP300)
   05167 Kaposi sarcoma-associated herpesvirus infection
    102983478 (EP300)
   05165 Human papillomavirus infection
    102983478 (EP300)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03000 Transcription factors [BR:pcad03000]
    102983478 (EP300)
   03036 Chromosome and associated proteins [BR:pcad03036]
    102983478 (EP300)
   03029 Mitochondrial biogenesis [BR:pcad03029]
    102983478 (EP300)
Enzymes [BR:pcad01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.48  histone acetyltransferase
     102983478 (EP300)
Transcription factors [BR:pcad03000]
 Eukaryotic type
  Other transcription factors
   Pocket domain CBP
    102983478 (EP300)
Chromosome and associated proteins [BR:pcad03036]
 Eukaryotic type
  Histone modification proteins
   HATs (histone acetyltransferases)
    102983478 (EP300)
Mitochondrial biogenesis [BR:pcad03029]
 Mitochondrial quality control factors
  Regulator of mitochondrial biogenesis
   Coactivators
    102983478 (EP300)
SSDB
Motif
Pfam: HAT_KAT11 KIX Creb_binding zf-TAZ DUF902 ZZ Bromodomain KIX_2 Npa1
Other DBs
NCBI-GeneID: 102983478
NCBI-ProteinID: XP_028346478
UniProt: A0A455BEY0
LinkDB
Position
6
AA seq 2421 aa
MSDFGSLFDLEHDLPDELINSTELGLTNGGDISQLQTSLGMVQDAASKHKQLSELLRSGS
SPNLNMGVSGPGQGMASQAQQNSPGLGLINSMVKSPMAQAGLTSPNMGMGTSGPNQGPTP
SATGMMNSPVNQPAMGMNTGMNAGMNPGMLTAGSGQGMLPNQVMNGSIGAGRGRPNMQYP
NPGMGNAGNLMTEPLQQGSPQMGGQTGLRGPQPLKMGMMNNPNPYGSPYTQNSGQQIGAS
GLGLQIPTKSVLPNSLSPFAMDKKAVPGGGMPNMGQQQTPQVQQPGLVTPVAQGMGSGAH
TADPEKRKLIQQQLVLLLHAHKCQRREQANGEVRQCNLPHCRTMKNVLNHMTHCQSGKSC
QVAHCASSRQIISHWKNCTRHDCPVCLPLKNAGDKRNQQSILTGAPVGLGNTSSLGVGQQ
STPSLSTVSQIDPSSIERAYAALGLPYQVNQMPTQPQVQAKNQQNQQSGQSPQGMRPMSN
MSASPMGVNGGVGVQTSNLLSDSMLHSAINSQNPMMSENASVASLGPMPTAAQPSSTGIR
KQWHEDITQDLRNHLVHKLVQAIFPTPDPAALKDRRMENLVAYARKVEGDMYESANNRAE
YYHLLAEKIYKIQKELEEKRRTRLQKQNMLPSAASMVPVSMNPGPNMGQPQPGMTSNGPL
PDPSMIRGSVPNQMMPRITPQPGLNQFGQMSMPQPPIGPRQTSPLQHHGQLGQPGTLNPP
MGYGPRMQQPSSQSQFLPQTQFSTQGMNVTNMPLAPSGSQAPVSQAQMSSSSCPVNSPIM
PPGSQGSHIHCPPLPQPALHQNSPSPVPSRTPTPHHTPPSIGAQQPPATAVPAPVPTPPA
MPPGPQSQALHPPPRQTPTPPPTQLPPQVQPSLPAAPSVDQAQQQPLSQQSTAASVPTPT
APLLPPQPATPLSQPAVSIEGQVSNPPSTSSTEVNSQAIPEKQPSQEVKMEAKMEVDAPE
PADTQPEDIPETKAEDCKAEPTETEERGAELKTETKEEEDQPSTSAAQSSPAPGQSKKKI
FKPEELRQALMPTLEALYRQDPESLPFRQPVDPQLLGIPPLLPTNCWSAFCLCGFVSSGH
FIKESLTDYFDIVKSPMDLSTIKRKLDTGQYQEPWQYVDDIWLMFNNAWLYNRKTSRVYK
YCSKLSEVFEQEIDPVMQSLGYCCGRKLEFSPQTLCCYGKQLCTIPRDATYYSYQNRYHF
CEKCFNEIQGESVSLGDDPSQPQTTINKEQFSKRKNDTLDPELFVECTECGRKMHQICVL
HHEIIWPSGFVCDGCLKKTARTRKENKFSAKRLPSTRLGTFLENRVNDFLRRQNHPESGE
VTVRVVHASDKTVEVKPGMKARFVDSGEMAESFPYRTKALFAFEEIDGVDLCFFGMHVQE
YGSDCPPPNQRRVYISYLDSVHFFRPKCLRTAVYHEILIGYLEYVKKLGYTTGHIWACPP
SEGDDYIFHCHPPDQKIPKPKRLQEWYKKMLDKAVSERIVHDYKDIFKQATEDRLTSAKE
LPYFEGDFWPNVLEESIKELEQEEEERKREENTSNESTDVTKGDSKNAKKKNNKKTSKNK
SSLSRGNKKKPGMPNVSNDLSQKLYATMEKHKEVFFVIRLIAGPAANSLPPIVDPDPLIP
CDLMDGRDAFLTLARDKHLEFSSLRRAQWSTMCMLVELHTQSQDRFVYTCNECKHHVETR
WHCTVCEDYDLCITCYNTKNHDHKMEKLGLGLDDESNNQQAAATQSPGDSRRLSIQRCIQ
SLVHACQCRNANCSLPSCQKMKRVVQHTKGCKRKTNGGCPICKQLIALCCYHAKHCQENK
CPVPFCLNIKQKLRQQQLQHRLQQAQMLRRRMASMQRAGVVGQQQGLPSPTPATPTTPTG
QQPTTPQTPQPPSQPQPTPPTSMPPYLPRTQAAGPVSQGKAAGQVTPPTPPQTAQPPLPG
PPPAAVEMAMQIQRAAETQRQMAHVQIFQRPIQHQMPQMTPMAPMGMNAPPMARGPGGHL
EPGVGPTGMQQPPPWAQGGLPQPQHLQPGVPRPAMMSVSQHGQPLNMAPQPGLGQVGVSP
LKPGTVSQQALQNLLRTLRSPSSPLQQQQVLSILHANPQLLAAFIKQRAAKYANSNPQPL
PGQPGVPQGQPGLQPPTMPGQQGVHSSPAMPNLNPMQAGVQRAGLPQQQAPQQQLPPPMG
GMSPQAQQMSMNHSAMPAQFRDILRRQQMMQQQQQQQGAGPGVGPGLASHSQFQPPQGLG
YPAPQPPPPPPPPRMQQHMQHLQQGSGGQLGQLPQALGAEAGAGLQAYQQRLLQQQMGSP
AQPNPMSPQQHMLPSQAQSPHLPGQQIPSLSNQVRSPQPVPSPRPQSQPPHSSPSPRMQP
QPSPHHVSPQTSSPHPGLVAAQGNPMEQGHFASPDQNSMLSQLTGNPGMANLHGASATDL
GLSTDNSDLNSNLSQSTLDIH
NT seq 7266 nt   +upstreamnt  +downstreamnt
atgtcagattttggctctctatttgacttggagcacgacttaccagatgaattaatcaac
tctacagaattgggactaaccaatggtggtgatattagtcagcttcagacgagccttggc
atggtacaagatgcagcctctaaacataaacaactgtcagaattgctacgttctggtagt
tcccctaacctcaacatgggggttagtggcccaggtcaaggcatggccagccaggcccaa
cagaacagtcctggattaggtttgataaatagcatggtcaaaagcccaatggcacaggca
ggcttgacttctcccaacatggggatgggcactagtggaccaaatcagggtcccacacca
tctgcaacgggtatgatgaacagtccagtaaatcagcctgccatgggaatgaacacgggg
atgaatgctggcatgaatcctgggatgttgactgcaggcagtggacaggggatgctgcct
aatcaagtcatgaacggttcaattggagcaggccgggggcgacctaatatgcagtaccca
aacccaggcatgggaaatgctggcaacttaatgactgagccactgcagcaaggctctccc
cagatgggaggacaaacaggattgagagggccccagcctcttaagatgggaatgatgaac
aaccctaatccttacggttcaccatacactcagaattctggacagcagattggagccagt
ggccttggtctacagattccgacaaagtctgtactaccaaacagcttatctccatttgca
atggacaaaaaggcagttcctggtggaggaatgcccaacatgggccagcagcagaccccg
caggtccagcagccgggcctggtgactccagtggcccaagggatgggttctggagcacac
acagctgatccagagaagcgcaagctcatccagcagcagcttgttctccttttgcacgct
cacaagtgccagcggcgagagcaggccaatggggaagtgaggcagtgcaaccttccccac
tgtcgtacaatgaagaacgtccttaaccacatgacacactgccagtcaggcaagtcctgc
caagtggcacactgtgcatcttctcgacaaatcatttcacactggaagaattgtacaagg
catgattgtcctgtgtgtctaccccttaaaaatgctggagataagagaaatcaacagtca
attctgactggagcaccagttggacttggaaatactagctctctaggggtgggtcaacag
tctactcccagcctaagcactgttagtcagattgatcccagctctatagaaagggcttat
gcagcccttggactaccctatcaagtaaatcagatgccaacacagccccaggtgcaagca
aagaaccagcagaaccagcagtctggacagtctccccaggggatgcggcccatgagcaac
atgagtgctagtcctatgggagtaaatggaggtgtaggggttcaaacgtcgaatcttctt
tctgactcgatgttgcattcagccataaattctcaaaacccaatgatgagtgaaaatgcc
agtgtggcctccctgggtcctatgccaacagcagctcaaccatccagtactggaattcgg
aaacaatggcatgaagatattactcaggatcttcgaaatcatcttgttcacaaacttgtt
caagccatatttcctactccggatcctgctgctttaaaagacagacggatggaaaacctg
gttgcatacgcccggaaagtggaaggggacatgtatgaatctgcgaacaatcgagcggaa
tactaccacctgctagctgagaagatctataagatccagaaagaactagaagaaaaacga
aggactagactacaaaaacagaacatgctaccaagtgctgcaagcatggtgccagtttct
atgaacccagggccgaacatggggcagccacaaccaggaatgacttctaatggccctcta
cctgatccatctatgatccgtggcagtgtgccaaaccagatgatgcctcggataactcca
caacctggtttgaatcaattcggccagatgagtatgccccagccccctattggaccccgg
caaacctctcctcttcagcaccatggacagttaggtcaacctggaactctcaacccgcct
atgggctatgggcctcgcatgcagcagccttccagccagagccagttccttcctcagact
cagttctcaacacagggaatgaatgtaacaaatatgcctttggctccatctggcagtcaa
gcaccagtgtctcaagcacaaatgtccagttcttcctgccctgtgaactctcctataatg
cctcctgggtctcaagggagccacattcactgtccccctctccctcaaccagctctgcat
cagaactcaccctcacctgtacctagtcgtaccccaacccctcaccacactccgccaagc
ataggggctcagcagccaccagcaacagcagttccagcccctgttcctacacctccagcc
atgccacctgggccacagtcccaggctctacatcctcctccaagacagacgcctacaccg
ccaccaacgcaacttcctccccaagtgcagccttcacttcctgctgctccttcagttgac
caggcacagcagcagcctctgtcccagcagagtacagcagcctctgtgcccaccccgaca
gcgccactgctgcctccgcagccggcaactccactttcccagccagctgtaagcatcgaa
ggtcaggtatcaaaccctccatctactagtagcacggaagtgaattctcaggccattcct
gagaagcagccttcacaggaagtgaaaatggaggctaaaatggaagtggatgcaccagaa
ccagcagatactcagccagaggatattccagagactaaagcagaagactgtaaagcggaa
cctacagaaacagaagagagaggcgctgaattaaaaactgaaacaaaagaggaggaagac
cagccaagtacttcagcagcccagtcatctccagccccaggacagtcaaaaaagaagatt
ttcaaacctgaagagttacgacaggcactgatgccgacattggaggcactttaccgacag
gatccagaatcccttccctttcgtcaacctgtggacccccagcttctaggaatccctccc
ctactaccaaccaactgctggtctgccttctgcctctgtggatttgtctcttctggacat
ttcatcaaagagagtcttacagattactttgatattgtgaagagccccatggatctttct
actatcaaaaggaagttagacactggacagtatcaggagccctggcagtatgtggatgac
atttggcttatgttcaacaatgcttggttatataatcggaaaacatcacgggtatacaaa
tactgctccaagctgtctgaggtctttgaacaagaaattgacccagtcatgcaaagcctt
ggatactgctgtggcagaaagttggagttctctccacagacactctgttgctatggcaaa
cagttatgcacaatccctcgtgatgccacttactacagttaccagaacaggtatcatttc
tgtgagaagtgtttcaatgaaatccaaggggagagcgtttctttgggggatgacccttcc
cagcctcaaactacaataaataaagaacaattttcgaagagaaaaaatgacactctggat
cctgaactatttgttgaatgtacggagtgtggaagaaagatgcatcagatctgtgtcctt
catcatgagatcatctggccatctggatttgtctgtgatggctgtttaaagaagactgca
cgaactagaaaagaaaataagttttctgctaaaaggttgccatctaccaggcttggcacc
tttctggagaatcgtgtgaatgactttctgaggcgacaaaatcaccctgagtcaggagag
gtcactgttagagtagttcatgcttctgacaaaactgtggaagtcaaaccaggcatgaaa
gcaaggtttgtagatagtggagagatggcagaatcctttccatatcgaaccaaagccctc
tttgcctttgaggagattgatggtgttgacttgtgtttctttggcatgcacgttcaagag
tatggttctgactgccccccgcccaaccagaggagagtatacatatcatacctggatagt
gttcatttcttccgtcctaaatgcttgaggactgcagtctatcatgaaattctaattgga
tatttggaatatgtcaagaaattaggatatacaacagggcatatttgggcatgcccccca
agtgagggagacgactacatcttccattgccacccccccgaccagaagatacccaagccc
aagcgactgcaggagtggtacaaaaagatgctcgacaaggctgtatccgagcgaattgtc
cacgactacaaggatatttttaaacaagctactgaagatcgattaacaagtgcaaaggaa
ttgccttactttgaaggtgatttctggcccaatgtactggaagagagcattaaggaactg
gaacaggaggaggaagagagaaagcgagaggagaacaccagcaacgaaagcacagatgtg
acaaagggagacagcaaaaatgctaaaaagaagaataataagaaaactagcaaaaacaag
agcagcctgagtaggggcaataagaagaagccaggcatgcccaatgtatccaatgacctc
tcgcaaaaactgtatgccaccatggagaagcataaagaggtcttcttcgtgatccgtctc
atcgccggccccgctgccaactccctgcctcccatcgttgaccccgatcccctcatcccc
tgcgacctgatggacgggcgggatgcctttctcaccctcgcaagggacaagcacctggag
ttctcctcactccgaagagcccagtggtccaccatgtgcatgctggtggagctgcacacc
cagagccaggaccgcttcgtctacacctgcaacgagtgcaagcaccacgtggagacgcgc
tggcactgcaccgtgtgcgaggattatgatttgtgtatcacctgctataacactaaaaac
catgaccacaaaatggagaaacttggtctcgggttggatgacgagagcaacaaccagcag
gccgcggccacccagagcccgggagactcccgccgcctgagcatccagcggtgcatccag
tctctggtccacgcctgccagtgccgaaatgccaactgctccctgccctcctgccagaag
atgaagcgggttgtgcagcacaccaagggctgcaagcggaagaccaacggagggtgcccc
atctgcaagcagctcatcgccctctgctgctaccacgccaagcactgccaggagaacaag
tgccccgtgcccttctgcctcaacatcaagcagaagctccggcagcagcagctacagcac
cggctccagcaagcccagatgctccgcaggaggatggccagcatgcagcgggctggcgtg
gtggggcagcagcagggcctgccctccccgacgcctgcgaccccgaccacgcccaccggc
cagcagccgaccaccccgcagacgccccagcccccctcccagccccagcccacccctccc
accagcatgccgccctacttgcccaggactcaggctgctggcccggtgtcccagggcaag
gcggccggccaggtcacccccccgacccctccgcagactgctcagccgccccttccagga
cccccacctgccgcggtggaaatggcgatgcagattcagagggcagccgagacgcagcgc
cagatggcccacgtgcaaatttttcaaaggccgatccagcaccagatgccccaaatgact
ccgatggcccccatgggtatgaacgcaccccccatggccagaggtcccggtgggcatttg
gagccaggggtggggcccacagggatgcagcagccaccgccgtgggcccaagggggattg
cctcagccccagcacctgcagcccggggtgcccaggccagccatgatgtcagtgtcacag
cacggtcagcccctgaacatggctccccaaccgggattgggccaggtaggtgtgagccct
ctcaaaccgggcactgtgtctcaacaagccttacagaaccttctgcggactctcaggtct
cccagctcccccctgcagcagcaacaggtgcttagtatccttcacgccaacccccagctg
ttggccgcgttcatcaagcagcgggctgccaagtacgccaactccaacccgcagcccctc
cccgggcagcctggcgtgccccagggccagccagggctgcagccccccaccatgccgggc
cagcagggggtccactccagccccgctatgccgaacttgaatcccatgcaggcgggcgtc
cagagggccggcctgccccagcagcaggcaccgcagcagcagctcccgccgcccatgggg
ggcatgagcccccaggctcagcagatgagcatgaatcacagcgccatgccggcgcagttc
cgagacatcctgaggcggcagcagatgatgcagcagcagcagcagcagcagggagcgggg
ccgggagtcgggcctgggctggccagccacagccagttccagccgccccagggcctgggc
taccctgccccccagccgccgccgccgccgccgccgccccggatgcagcagcacatgcag
cacctgcagcaagggagcgggggccagctgggccagctcccccaggccctgggggcagag
gcaggagccggtctgcaggcctatcagcagcgactccttcagcaacagatggggtcaccc
gctcagcccaaccccatgagcccccagcagcatatgctcccgagtcaggctcagtccccg
caccttccaggccagcagatcccatctctctccaatcaagtgcggtctccccagcctgtt
ccttctccgcggccacagtcccagcccccccactccagcccttccccacggatgcagcct
cagccttctccacaccacgtttccccacagaccagttctccacatcccggactggtcgct
gcccagggcaaccccatggaacaagggcattttgccagcccggaccagaattcaatgctc
tctcagctgactggcaatccaggcatggcaaacctccatggtgccagcgccacggacctg
ggactcagcaccgacaactcagacttgaattcaaacctctcacagagtacactagacata
cactag

KEGG   Physeter catodon (sperm whale): 102991594
Entry
102991594         CDS       T06011                                 

Gene name
CREBBP
Definition
(RefSeq) CREB-binding protein
  KO
K04498  E1A/CREB-binding protein [EC:2.3.1.48]
Organism
pcad  Physeter catodon (sperm whale)
Pathway
pcad04024  cAMP signaling pathway
pcad04066  HIF-1 signaling pathway
pcad04068  FoxO signaling pathway
pcad04110  Cell cycle
pcad04310  Wnt signaling pathway
pcad04330  Notch signaling pathway
pcad04350  TGF-beta signaling pathway
pcad04520  Adherens junction
pcad04630  JAK-STAT signaling pathway
pcad04720  Long-term potentiation
pcad04916  Melanogenesis
pcad04919  Thyroid hormone signaling pathway
pcad04922  Glucagon signaling pathway
pcad04935  Growth hormone synthesis, secretion and action
pcad05016  Huntington disease
pcad05152  Tuberculosis
pcad05161  Hepatitis B
pcad05164  Influenza A
pcad05165  Human papillomavirus infection
pcad05166  Human T-cell leukemia virus 1 infection
pcad05167  Kaposi sarcoma-associated herpesvirus infection
pcad05200  Pathways in cancer
pcad05203  Viral carcinogenesis
pcad05206  MicroRNAs in cancer
pcad05211  Renal cell carcinoma
pcad05215  Prostate cancer
Brite
KEGG Orthology (KO) [BR:pcad00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04310 Wnt signaling pathway
    102991594 (CREBBP)
   04330 Notch signaling pathway
    102991594 (CREBBP)
   04350 TGF-beta signaling pathway
    102991594 (CREBBP)
   04630 JAK-STAT signaling pathway
    102991594 (CREBBP)
   04066 HIF-1 signaling pathway
    102991594 (CREBBP)
   04068 FoxO signaling pathway
    102991594 (CREBBP)
   04024 cAMP signaling pathway
    102991594 (CREBBP)
 09140 Cellular Processes
  09143 Cell growth and death
   04110 Cell cycle
    102991594 (CREBBP)
  09144 Cellular community - eukaryotes
   04520 Adherens junction
    102991594 (CREBBP)
 09150 Organismal Systems
  09152 Endocrine system
   04922 Glucagon signaling pathway
    102991594 (CREBBP)
   04935 Growth hormone synthesis, secretion and action
    102991594 (CREBBP)
   04919 Thyroid hormone signaling pathway
    102991594 (CREBBP)
   04916 Melanogenesis
    102991594 (CREBBP)
  09156 Nervous system
   04720 Long-term potentiation
    102991594 (CREBBP)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    102991594 (CREBBP)
   05206 MicroRNAs in cancer
    102991594 (CREBBP)
   05203 Viral carcinogenesis
    102991594 (CREBBP)
  09162 Cancer: specific types
   05211 Renal cell carcinoma
    102991594 (CREBBP)
   05215 Prostate cancer
    102991594 (CREBBP)
  09164 Neurodegenerative disease
   05016 Huntington disease
    102991594 (CREBBP)
  09171 Infectious disease: bacterial
   05152 Tuberculosis
    102991594 (CREBBP)
  09172 Infectious disease: viral
   05166 Human T-cell leukemia virus 1 infection
    102991594 (CREBBP)
   05161 Hepatitis B
    102991594 (CREBBP)
   05164 Influenza A
    102991594 (CREBBP)
   05167 Kaposi sarcoma-associated herpesvirus infection
    102991594 (CREBBP)
   05165 Human papillomavirus infection
    102991594 (CREBBP)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03000 Transcription factors [BR:pcad03000]
    102991594 (CREBBP)
   03036 Chromosome and associated proteins [BR:pcad03036]
    102991594 (CREBBP)
   03029 Mitochondrial biogenesis [BR:pcad03029]
    102991594 (CREBBP)
Enzymes [BR:pcad01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.48  histone acetyltransferase
     102991594 (CREBBP)
Transcription factors [BR:pcad03000]
 Eukaryotic type
  Other transcription factors
   Pocket domain CBP
    102991594 (CREBBP)
Chromosome and associated proteins [BR:pcad03036]
 Eukaryotic type
  Histone modification proteins
   HATs (histone acetyltransferases)
    102991594 (CREBBP)
Mitochondrial biogenesis [BR:pcad03029]
 Mitochondrial quality control factors
  Regulator of mitochondrial biogenesis
   Coactivators
    102991594 (CREBBP)
SSDB
Motif
Pfam: KIX DUF902 zf-TAZ Bromodomain KIX_2
Other DBs
NCBI-GeneID: 102991594
NCBI-ProteinID: XP_028353814
UniProt: A0A455BXS0
LinkDB
Position
14
AA seq 1403 aa
MDGRAEPRQEGRLRARPTLGGARGPDLPCSLKSWGRWGSWGSRCAAGQRSFAPCAARFLA
SFEALSGELRARTSQDLDLARPLEKMDYFGSLFDLENDLPDELIPNGGELGLLNSGNLVP
DAASKHKQLSELLRGGSSSSINPGIGNVSASSPVQQGLGGQAQGQPNSANMASLGAMGKS
PLNQGDSSAPSLPKQAASTSGPTPPASQALNPQAQKQVGLVTSSPATSQTGPGICMNANF
NQTHPGLLNSNSGHSLMNPAQQGQAQVMNGSLGAAGRGRGAGMPYATPAMQGAGSSVLAE
TLTQVSPQMAGHAGLNTAQAGGMSKMGMTGNTSPFGQPFSQTGGQQMGAPGVNPQLPSKQ
SMVNSLPPFAADIKNASVTNVPNMSQMQTSVGIGPTQAIATGPTADPEKRKLIQQQLVLL
LHAHKCQRREQANGEVRACSLPHCRTMKNVLNHMTHCQAGKACQVAHCASSRQIISHWKN
CTRHDCPVCLPLKNASDKRNQQTILGSPASGIQNTIGSVGTGQQSATSLSNPNPIDPSSM
QRAYAALGLPYLNQPQTQLQPQVPGQQPAQPQTHQQMRTLNPLGNNPMNIPAGGITTDQQ
PPNLISESALPTSLGAANPLISDGSNSGNIGTLSTIPTAAPPSSTGVRKGWHEHVTQDLR
SHLVHKLVQAIFPTPDPAALKDRRMENLVAYAKKVEGDMYESANSRDEYYHLLAEKIYKI
QKELEEKRRSRLHKQGILGNQPALPAPGTQPPGIPQAQPVRPPNGPMPLPVNRMQVSQGM
NSFNPISLGNVQLPQAPMGPRASSPMNHSVPMNSMGSVPGMAISPSRMPQPPNLMGTHTN
NMMAQAPTQNQFLPQNQFPSSSGALNVNSVGMGQPAAQASVSQGQVPGAALPNPLNMLGP
QASQLPCPPVTQSPLHQTTPPASTAAGMPSLQHPAAPGMTPPQPAAPTQPSTPVSSSGQT
PTPTPGSVPSASQTQSTPTVQAAAQAQVTPQPQTPVQPPSVATPQSSQQQPTPVHTQPPG
TPLSQAAASIDNRVPTPSSVASAETNSQQPGPDVPMLEMKAEVKTEDTEPDVSEPKAEPG
AAMMEEDLQGSSQVKEETDTTEQKSEPMEVDEKKPEVKVEAKEEEESSTNGTASQSTSPS
QPRKKIFKPEELRQALMPTLEALYRQDPESLPFRQPVDPQLLGIPDYFDIVKNPMDLSTI
KRKLDTGQYQEPWQYVDDVWLMFNNAWLYNRKTSRVYKFCSKLAEVFEQEIDPVMQSLGY
CCGRKYEFSPQTLCCYGKQLCTIPRDAAYYSYQNRYHFCEKCFTEIQGENVTLGDDPSQP
QTTISKDQFEKKKNDTLDPEPFVDCKECGRKMHQICVLHYDIIWPSGFVCDNCLKKTGRT
RKENKFSAKSKLWKGFCIFLSYP
NT seq 4212 nt   +upstreamnt  +downstreamnt
atggatggtagggctgagccccgccaggagggccggctgcgggcccggccaacgctaggt
ggcgcccgagggccggatctgccctgctccctgaagtcctgggggcgctggggatcctgg
gggtcccgctgcgctgctgggcagcggagcttcgccccttgtgctgcccggttcctcgcc
tctttcgaagcactatcgggagaattacgtgcaagaacttctcaagacctagaccttgcc
cgacccctagagaagatggactattttggatcattgtttgacttggaaaatgatcttccc
gatgagctgatccccaatggaggagaattaggccttttaaacagtgggaaccttgttcca
gatgctgcttccaaacataaacaactgtcagagcttctgcgaggaggcagcagctctagt
atcaacccaggaataggaaatgtgagcgccagcagccccgtgcaacaaggccttggaggc
caggcccaggggcagccgaacagtgcgaacatggccagtctgggtgccatgggcaagagc
cctctgaaccagggagattcttcagcccctagcctgcccaaacaggcagccagcacctct
gggcccactccccctgcttcccaagcactgaatcctcaagcacaaaagcaagtggggctg
gtgaccagcagccctgccacgtcacagacaggacctgggatctgcatgaatgctaatttt
aaccagacccacccaggcctcctcaatagtaactctggccatagtttaatgaacccggcc
cagcaagggcaggcgcaagtcatgaatggatctcttggggctgctggcagaggaagggga
gctggaatgccatatgctactccggccatgcagggggccgggagcagcgtgctggctgag
acattaactcaagtttcaccgcaaatggctggtcatgcagggctgaacacagcgcaagcc
ggaggcatgagcaagatgggaatgactggtaacacaagtccatttggacaaccctttagt
caaactggagggcagcagatgggagcccctggagtgaaccctcagctgcccagcaagcag
agcatggtcaatagcttgcctccctttgctgcagacatcaagaatgcttcagtcaccaac
gtgccaaacatgtctcagatgcaaacatcagtgggaattggacccacacaggcaattgca
acgggccctactgcagatcctgaaaaacgcaaactgatacagcagcagctggttctactg
cttcacgctcataaatgtcagaggcgagaacaagcaaatggagaggttcgggcctgctct
ctcccacattgtcgaaccatgaaaaatgttttgaatcacatgacgcattgtcaggctggg
aaagcctgtcaagttgcccattgtgcatcttcacgacaaatcatctctcattggaagaac
tgcacacgacatgactgtcctgtttgcctccctttgaaaaatgccagtgacaagcgaaac
caacaaaccatcctggggtctccagctagtggaattcaaaacacaattggttctgttggc
acaggccaacagagtgccacttctttaagtaacccaaatcccatagaccccagctccatg
caacgagcgtatgctgctcttggactcccctacctgaaccagccccagacgcagctgcag
cctcaggttcctggccagcaaccagcacagcctcaaactcaccagcagatgaggactctc
aaccccctgggaaataacccaatgaacattccagcaggaggaataacaacagatcagcag
ccaccaaacttgatttcagaatcagctcttccaacttcccttggggccgcgaacccactg
atcagtgacggctcaaactctggaaacattggaaccctcagcactatacccacagcagca
cctccttccagcactggcgttcggaaaggctggcacgaacatgtcactcaggacctgcgg
agccatctagtgcataaacttgtccaagccatcttcccaacacctgaccctgcagccctg
aaggatcgccgcatggagaacctggtggcctacgctaagaaagtggaaggggacatgtat
gagtctgccaacagccgggatgagtactatcacttactagcagagaaaatctacaagata
caaaaagaactagaagaaaaacggagatcgcgtttacataaacaaggcatcttgggtaac
cagccagccttaccagcccctgggacacagcctcctgggataccacaggcacagcctgtg
agacctccaaatgggcccatgcctctgccagtgaatcgcatgcaggtttctcaagggatg
aattcatttaacccaatatccttggggaatgtacagttgccacaagctcccatgggacct
cgcgcatcatcccccatgaaccactctgtcccgatgaacagcatgggctccgttccaggg
atggccatttctccttcccgaatgcctcagcctccgaacctgatgggtacacacaccaac
aacatgatggcccaggcacctacccagaaccagttcctgccacagaaccagttcccatcc
tccagcggggcgctgaacgtgaacagcgtgggcatggggcagccagcggcccaggccagt
gtgtcacagggacaggtgcctggtgctgctcttcctaaccctctgaacatgcttgggccc
caggccagccagctgccttgcccaccagtgacacagtcaccgttacaccagactacacct
cctgcttccacggccgcaggcatgccatctcttcagcatccggcggcacctgggatgact
cctccccagccagcagctcccacccagccatcaactcctgtgtcgtcttccgggcagact
cccaccccgactcccggctcagtgcccagtgccagccaaacccagagcacccctacagtc
caggcggcagcccaggcccaggtgaccccacagcctcagaccccagtccagcctccgtcc
gtggccacccctcagtcgtcacagcagcagccgacacctgtacacacccagcctcctggc
acaccgctttcccaggcagcagccagcattgataacagggtccccactccatcctcagtg
gccagcgccgaaaccaactcccagcagccaggacccgatgtaccaatgctggaaatgaag
gctgaggtcaagaccgaggacaccgagcctgatgtcagtgaacccaaggcagagcctggg
gctgcgatgatggaggaggacttacaaggatcttctcaagttaaagaagaaacagacaca
acagagcagaagtcggaaccaatggaagtggatgaaaagaaacctgaagtgaaagttgaa
gctaaagaggaagaagagagtagcaccaacgggacagcctctcagtccacttctccttct
cagcctcgcaaaaaaatctttaagccggaggagttgcgccaggctctcatgccaacccta
gaagcgctgtatcgacaggatccagagtccctaccttttcgacagcctgtagatccccag
ctcctaggaattccagattattttgacattgtgaagaatcccatggacctttccaccatc
aagcggaagctggatacagggcagtaccaggaaccctggcagtatgtggatgacgtctgg
ctcatgttcaacaatgcctggctctacaatcggaagacatcccgggtctataagttctgc
agtaagctcgcagaggtctttgagcaagaaattgaccctgttatgcaatcccttggatat
tgctgtggacgcaagtatgagttttccccacagactttgtgctgctacgggaagcagctg
tgtacaattcctcgcgatgctgcctactacagctatcagaataggtatcatttctgtgag
aagtgtttcacagagatccagggggagaatgttaccctgggtgacgacccttcacaaccc
cagacgacaatttcaaaggatcagtttgaaaagaagaaaaatgataccttagatcctgaa
cctttcgttgattgcaaggagtgtggccggaagatgcatcagatttgtgttctccactac
gatatcatttggccttcaggctttgtgtgcgacaactgcttgaagaaaacgggcagaact
cgtaaagaaaacaaattcagtgctaagagtaagttgtggaagggtttttgtatttttttg
tcttacccttga

KEGG   Physeter catodon (sperm whale): 114485354
Entry
114485354         CDS       T06011                                 

Definition
(RefSeq) CREB-binding protein
  KO
K04498  E1A/CREB-binding protein [EC:2.3.1.48]
Organism
pcad  Physeter catodon (sperm whale)
Pathway
pcad04024  cAMP signaling pathway
pcad04066  HIF-1 signaling pathway
pcad04068  FoxO signaling pathway
pcad04110  Cell cycle
pcad04310  Wnt signaling pathway
pcad04330  Notch signaling pathway
pcad04350  TGF-beta signaling pathway
pcad04520  Adherens junction
pcad04630  JAK-STAT signaling pathway
pcad04720  Long-term potentiation
pcad04916  Melanogenesis
pcad04919  Thyroid hormone signaling pathway
pcad04922  Glucagon signaling pathway
pcad04935  Growth hormone synthesis, secretion and action
pcad05016  Huntington disease
pcad05152  Tuberculosis
pcad05161  Hepatitis B
pcad05164  Influenza A
pcad05165  Human papillomavirus infection
pcad05166  Human T-cell leukemia virus 1 infection
pcad05167  Kaposi sarcoma-associated herpesvirus infection
pcad05200  Pathways in cancer
pcad05203  Viral carcinogenesis
pcad05206  MicroRNAs in cancer
pcad05211  Renal cell carcinoma
pcad05215  Prostate cancer
Brite
KEGG Orthology (KO) [BR:pcad00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04310 Wnt signaling pathway
    114485354
   04330 Notch signaling pathway
    114485354
   04350 TGF-beta signaling pathway
    114485354
   04630 JAK-STAT signaling pathway
    114485354
   04066 HIF-1 signaling pathway
    114485354
   04068 FoxO signaling pathway
    114485354
   04024 cAMP signaling pathway
    114485354
 09140 Cellular Processes
  09143 Cell growth and death
   04110 Cell cycle
    114485354
  09144 Cellular community - eukaryotes
   04520 Adherens junction
    114485354
 09150 Organismal Systems
  09152 Endocrine system
   04922 Glucagon signaling pathway
    114485354
   04935 Growth hormone synthesis, secretion and action
    114485354
   04919 Thyroid hormone signaling pathway
    114485354
   04916 Melanogenesis
    114485354
  09156 Nervous system
   04720 Long-term potentiation
    114485354
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    114485354
   05206 MicroRNAs in cancer
    114485354
   05203 Viral carcinogenesis
    114485354
  09162 Cancer: specific types
   05211 Renal cell carcinoma
    114485354
   05215 Prostate cancer
    114485354
  09164 Neurodegenerative disease
   05016 Huntington disease
    114485354
  09171 Infectious disease: bacterial
   05152 Tuberculosis
    114485354
  09172 Infectious disease: viral
   05166 Human T-cell leukemia virus 1 infection
    114485354
   05161 Hepatitis B
    114485354
   05164 Influenza A
    114485354
   05167 Kaposi sarcoma-associated herpesvirus infection
    114485354
   05165 Human papillomavirus infection
    114485354
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03000 Transcription factors [BR:pcad03000]
    114485354
   03036 Chromosome and associated proteins [BR:pcad03036]
    114485354
   03029 Mitochondrial biogenesis [BR:pcad03029]
    114485354
Enzymes [BR:pcad01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.48  histone acetyltransferase
     114485354
Transcription factors [BR:pcad03000]
 Eukaryotic type
  Other transcription factors
   Pocket domain CBP
    114485354
Chromosome and associated proteins [BR:pcad03036]
 Eukaryotic type
  Histone modification proteins
   HATs (histone acetyltransferases)
    114485354
Mitochondrial biogenesis [BR:pcad03029]
 Mitochondrial quality control factors
  Regulator of mitochondrial biogenesis
   Coactivators
    114485354
SSDB
Motif
Pfam: HAT_KAT11 Creb_binding ZZ zf-TAZ Npa1
Other DBs
NCBI-GeneID: 114485354
NCBI-ProteinID: XP_028342444
UniProt: A0A455B1P8
LinkDB
Position
Unknown
AA seq 1152 aa
IPSVFGECYSLQYQTTLKEVVSVTSTLPKPSHLLVLDFAGLQTTRLGNHLEDRVNKFLRR
QNHPEAGEVFVRVVASSDKTVEVKPGMKSRFVDSGEMSESFPYRTKALFAFEEIDGVDVC
FFGMHVQEYGSDCPPPNTRRVYISYLDSIHFFRPRCLRTAVYHEILIGYLEYVKKLGYVT
GHIWACPPSEGDDYIFHCHPPDQKIPKPKRLQEWYKKMLDKAFAERIIHDYKDIFKQATE
DRLTSAKELPYFEGDFWPNVLEESIKELEQEEEERKKEESTAASETPEGSQGDSKNAKKK
NNKKTNKNKSSISRANKKKPSMPNVSNDLSQKLYATMEKHKEVFFVIHLHAGPVINTLPP
IVDPDPLLSCDLMDGRDAFLTLARDKHWEFSSLRRSKWSTLCMLVELHTQGQDRFVYTCN
ECKHHVETRWHCTVCEDYDLCINCYNTKSHTHKMVKWGLGLDDEGSSQGEPQSKSPQESR
RLSIQRCIQSLVHACQCRNANCSLPSCQKMKRVVQHTKGCKRKTNGGCPVCKQLIALCCY
HAKHCQENKCPVPFCLNIKHKLRQQQIQHRLQQAQLMRRRMATMNTRNVPQQSLPSPTSA
PPGTPTQQPSTPQTPQPPAQPQPSPVNMSPAGFPSVARTQPPTTVSTGKPTNQVPAPPPP
AQPPPAAVEAARQIEREAQQQQHLYRVNINNSMPPGRTGMVTPVSQMAPVGLNVPRPNQV
SGPVVPNLPPGQWQQAPIPQQQPMPGMPRPVMSMQAQPAVAGPRMPSVQPPRSISPGALQ
DLLRTLKSPSSPQQQQQVLNILKSNPQLMAAFIKQRTAKYVASQPGLQPQPGLQPQPGLQ
PQPGLHQQPSLQNLNAMQAGGPRPGVPPQQPAMGGLNPQGQALNIMNPGHNPSMASMNPQ
YREMLRRQLLQQQQQQQQQQQQQQQQQGSAGMAGGMAGHGQFQQPQGPGGYPAAMQQQRM
QQHLPIQGSSMGQMAAQIGQLSQMGQPGLGADSTPNIQQALQQRILQQQQMKQQIGSPGQ
PNPMSPQQHMLSGQPQASHLPGQQMATSLSSQVRSPAPVQSPRPQSQPPHSSPSPRIQPQ
PSPHHVSPQTGSPHPGLAVTMASSIDQGHLGNPEQSAMLPQLNTPNRSALSNELSLVGDT
TGDTLEKFVEGL
NT seq 3459 nt   +upstreamnt  +downstreamnt
atcccttctgtatttggagaatgttactccttacaataccagactacactgaaagaggtg
gtttctgtgacctcaaccctcccgaagccctctcatctgcttgtgctggactttgcagga
ctgcagaccacacggttgggaaaccacttggaagaccgagtcaacaagtttttgcggcga
cagaatcatcctgaagccggggaggtgtttgtccgtgtagtggccagctcagacaagacg
gtggaggtcaagcccgggatgaagtcacggtttgtggattctggggaaatgtctgaatct
ttcccgtatcgaaccaaagcactctttgcctttgaggaaattgatggagtggacgtgtgc
ttctttgggatgcacgtccaagagtatggctctgattgcccccctccaaacacaaggcgt
gtgtacatatcttatctggacagtattcatttcttccgaccccgatgcctccgaacagct
gtttaccatgagatccttattggatatttagagtacgtgaagaaattggggtatgtaaca
ggacacatctgggcctgtcccccaagtgaaggagacgactacatcttccattgccacccc
ccggatcaaaaaatccccaagccaaagcgcctgcaggagtggtacaagaagatgctggac
aaggcctttgccgagcgcatcatccatgactataaggacattttcaaacaagcaactgaa
gacaggctcaccagtgccaaggaactgccctatttcgagggtgacttctggcctaacgtg
ttggaggagagcattaaggagctggaacaggaggaagaagagaggaagaaggaggagagc
accgcggcaagtgagaccccggagggcagccagggcgacagcaagaatgccaagaaaaag
aacaacaagaaaaccaacaagaataaaagcagcatcagccgagccaacaagaaaaagccc
agcatgcccaacgtgtccaacgacttgtcccagaagctctatgccacgatggagaagcac
aaagaggtcttctttgtgatccacctccacgctgggcccgtcatcaacacgctgcccccc
atcgtcgaccccgaccccctgctcagctgtgacctcatggacggacgggacgccttcctc
acgctggcccgggacaagcattgggagttctcctccttgcggcgttccaagtggtccacg
ctgtgcatgctggtagagctgcacacccagggccaggaccgcttcgtctacacctgcaac
gagtgcaagcaccacgtggagacgcgctggcactgcaccgtgtgcgaggactatgacctc
tgcatcaactgctacaacacgaagagccacacccacaagatggtgaagtgggggctgggc
ctggacgacgagggcagcagccagggtgagccacagtccaagagcccccaggagtcgcgg
cgcctgagcatccagcgctgcatccagtccctggtgcacgcctgccagtgccgcaacgcc
aactgctcactgccgtcctgccagaagatgaagcgggtggtgcagcacaccaagggttgc
aagcgcaagaccaacggcggctgcccagtgtgcaagcagctcattgccctctgctgctac
catgccaaacactgccaagaaaacaagtgccccgtgcccttctgcctcaacatcaaacac
aagctccgccagcagcagatccagcaccgcctgcagcaggcccagctcatgcgccggcgg
atggccaccatgaacacccgcaacgtgcctcagcagagcctgccttcccctacctcagca
ccacccgggacccccacgcagcagcccagcacgccccagacgccacagccccccgcccag
ccgcagccctcgcctgtgaacatgtcaccagctggcttccccagtgtggcccggactcag
cccccaacaacggtgtccaccgggaagcccaccaaccaggtgccggccccaccgcccccc
gcccagcccccacccgcggcagtggaggcggcccggcagattgagcgggaggcccagcag
cagcagcacctgtaccgggtgaacatcaacaacagcatgcccccagggcgcacgggcatg
gtgaccccggtgagccagatggcccccgtgggcctgaacgttccccgacccaaccaggtc
agcgggcccgtcgtgcccaacctgccacctgggcagtggcagcaggcgcccatcccccag
cagcagccgatgccaggcatgcccagacccgtgatgtccatgcaggcccagccggccgtg
gctgggccgcggatgcccagcgtgcaaccgccccggagcatctcgcccggcgccctgcag
gacctgcttcggaccctgaagtcccccagctccccacagcagcagcagcaggtgctcaac
atcctcaagtccaaccctcagctgatggcagctttcattaaacagcgcacggccaagtac
gtggccagtcagcccggcctgcagccccaacccggcctgcagccccagcccggcctacag
ccccagcccggcctgcaccagcagcccagcctgcagaacctgaatgccatgcaagccggc
gggccgcggcccggcgtgcctccacagcagccggcgatgggcggcctgaacccccagggc
caggccctgaacatcatgaacccagggcacaaccccagcatggcaagtatgaacccacag
tacagagagatgctgcgaaggcagctcctgcagcagcagcaacaacagcagcagcagcag
cagcaacagcagcagcagcagggcagtgccggcatggccgggggcatggcggggcacggc
cagttccagcagcctcagggacctggaggctaccctgcggccatgcaacagcagcggatg
cagcagcacctccccatccagggcagctccatgggccagatggcggcccagataggacag
ctcagccagatggggcagcctgggctgggcgcagacagcacccccaacatccagcaggcc
ttgcagcagcggattctgcagcagcagcagatgaagcagcagatcgggtccccgggccag
ccgaatcccatgagcccccagcagcacatgctctcaggacagccgcaggcctcacacctc
cccggccagcagatggccacgtccctcagtagccaggtgcggtctccggcccctgtccag
tctccgcggccccagtcccagcctccacattccagcccgtcgccacggatacagccccag
ccttcaccacaccacgtctcgccccagactggttccccccacccaggactcgcagttacc
atggccagctccatagatcagggacacttggggaaccccgaacagagtgcaatgctcccc
cagctgaacacccccaacaggagtgcgttgtccaatgagctgtccctggtcggcgacacc
acgggagacactctagaaaagtttgtggagggtttgtag

DBGET integrated database retrieval system