KEGG   Physeter catodon (sperm whale): 102983752
Entry
102983752         CDS       T06011                                 

Gene name
EML4
Definition
(RefSeq) echinoderm microtubule-associated protein-like 4 isoform X1
  KO
K15420  echinoderm microtubule-associated protein-like 4
Organism
pcad  Physeter catodon (sperm whale)
Pathway
pcad05200  Pathways in cancer
pcad05223  Non-small cell lung cancer
pcad05235  PD-L1 expression and PD-1 checkpoint pathway in cancer
Brite
KEGG Orthology (KO) [BR:pcad00001]
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    102983752 (EML4)
   05235 PD-L1 expression and PD-1 checkpoint pathway in cancer
    102983752 (EML4)
  09162 Cancer: specific types
   05223 Non-small cell lung cancer
    102983752 (EML4)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04812 Cytoskeleton proteins [BR:pcad04812]
    102983752 (EML4)
Cytoskeleton proteins [BR:pcad04812]
 Eukaryotic cytoskeleton proteins
  Microtubules
   Tubulin-binding proteins
    EMAP
     102983752 (EML4)
SSDB
Motif
Pfam: HELP WD40 ANAPC4_WD40 Ribosomal_S7 SlyX
Other DBs
NCBI-GeneID: 102983752
NCBI-ProteinID: XP_007112246
UniProt: A0A2Y9F0V3
LinkDB
Position
12
AA seq 1006 aa
MEDRLPGLASVCASSTLRSFCTDDSISAASTSDVQDRLSALELRVQQQEDEITVLKAALA
DVLRRLTISEDHVASVKKSVPSKGQPGIREAISMSCITNGSGANRKPSHTSSVSIARKET
LSSAAKSGTEKKKEKPQGQREKKEESHSNDQSPQIRASPSPQPSSQPLQTHRQTQESKNS
TPTKSIKRPPTAEKSHNSWENSDDSRNKLLRAVSTSKLISKVIKNADKHKDVIINQAKMS
TREKNSQEGEYVKMFMRGRPITMFIPSDVDNYDDIRTELPPEKLKLEWVYGYRGKDCRAN
VYLLPTGEIVYFIASVVVLFNYEERTQRHYLGHTDCVKCLAIHPDKIRIATGQIAGVDKD
GRPLQPHVRVWDSVSLSTLQIIGLGTFERGVGCLDFSKADSGVHLCVIDDSNEHMLTVWD
WQKKSKGAEIKTTNEVVLAVEFHPTDANTIITCGKSHIFFWTWSGNSLTRKQGVFGKYEK
PKFVQCLTFLGNGDVLTGDSGGVILIWSKTTVEPTPGKGPKGVYQISRQIKAHDGSVFTL
CQMRNGMLLTGGGKDRKIILWDHDLNPEREIEVPDQYGTIRAVAEGKADQFLVGTSRNFI
LRGTFNDGFQIEVQGHTDELWGLATHPFKDLLLTCAQDRQVCMWNSVEHRLEWTRLVDEP
GHCADFHPSGTVVAIGTHSGRWFVLDAETRDLVSIHTDGNEQLSVMRYSLDGTFLAVGSH
DNFIYLYVVSENGRKYSRHGKCTGHSSYITHLDWSPDNKYIMSNSGDYEILYWDIPNGCK
LIRNRSDCKDIDWTTYTCVLGFQVFGVWPEGSDGTDINALVRSHNRKVIAVADDFCKVHL
FQYPCSKAKAPSHKYSAHSSHVTNVSFTHNDSHLISTGGKDMSIIQWKLVEKLSLPQNEV
VADTALTKAPVSSIESVMQSDAPAPPPSQPLNETAEEESRISSSPTLLENSLEQTVGPSA
DHSEERSEGGSEDLGEPVYEEPARGMSDERSEGALPGDQQDPSPLS
NT seq 3021 nt   +upstreamnt  +downstreamnt
atggaagaccgcttgcctggtctcgcttcagtgtgtgcttcctctacacttaggagcttc
tgcactgatgatagtatttctgctgcaagtacttctgatgttcaagatcgcctctcagcc
cttgagttacgagttcaacaacaagaagatgaaatcactgtgctaaaggcagcattggct
gatgttttgaggcgtcttacaatctctgaagatcatgtagcctcagtgaaaaaatcagtc
ccaagtaaaggccagccaggcattcgagaagctatttccatgtcctgtataaccaatggg
agtggtgcaaacagaaaaccaagtcacaccagctctgtttcaatcgcaagaaaagaaact
ctttcatctgctgctaaaagtggtacagaaaaaaagaaagaaaaaccacaaggacagaga
gaaaaaaaagaggaatctcactctaatgatcaaagtccacaaattcgagcatcaccttct
ccccagccctcttcacagcctctccaaacacacagacaaactcaagaaagcaagaattct
actcccaccaaaagcataaaacgaccaccaacagctgaaaagtcacataattcatgggaa
aattcagacgatagccgtaataaattactgagggcagtttcaacatcaaaattaatatca
aaagttataaaaaatgcagacaagcataaagatgtcatcatcaaccaagcaaaaatgtca
acccgtgaaaaaaacagccaagaaggagaatatgttaaaatgtttatgcgaggtcgacca
attacaatgttcattccttctgatgttgacaactatgatgacatcagaacagagctgcct
cctgagaagctcaaactggagtgggtatatggttatcgaggaaaggactgtcgagctaat
gtttaccttcttcctaccggggaaatcgtttatttcatagcgtcagtagtagtactattt
aattatgaggagagaactcaacgacactacctgggtcatacagactgtgtgaaatgcctt
gctatacatcctgacaaaattaggattgcaactggacagatagctggagtggataaggat
ggaaggcccctgcagccccatgtcagagtgtgggattcagttagtctgtctacactgcaa
attattggacttggaacttttgagcgtggagtaggatgcctggatttttcaaaagcagat
tcaggtgttcatttatgtgtcatcgatgactccaatgagcatatgcttactgtatgggat
tggcagaagaaatcaaaaggagcagaaataaagacaacaaatgaagttgttttggctgtg
gaattccatccaacagatgcaaataccataataacctgtggtaaatctcacatttttttc
tggacctggagtggcaattcactaacaagaaaacagggagtttttgggaaatacgaaaaa
ccaaaatttgtgcagtgtttgacattcttggggaatggagatgttcttactggagactca
ggtggagtcatacttatatggagcaaaactactgtagaacccacacctgggaaagggcct
aaaggtgtttatcagatcagcagacaaatcaaagctcatgatggcagtgtgttcacactt
tgtcagatgagaaatggtatgttattaactggaggcgggaaagacagaaaaataattctg
tgggatcatgatctgaatcctgaaagagaaatagaggttcctgatcagtatggaacaatc
agagctgtagcagaaggaaaggcagatcaatttttggtaggcacatcacgaaactttatt
ttacggggaacatttaatgatggcttccaaatagaagtacagggtcatactgatgagctt
tggggtcttgccacacatcccttcaaagatttgctcttgacatgtgctcaggacagacag
gtgtgcatgtggaactcggtggaacacaggctggaatggaccaggctcgtagatgaacca
ggacactgtgcagattttcatccaagtggcacagtggtggccataggaacgcactcaggc
aggtggtttgttctggatgcagaaaccagagatctagtttctatccacacagacgggaat
gaacagctctctgtgatgcgctactcattagatggcaccttcctggctgtgggatctcat
gacaactttatttacctctatgtggtctcagaaaatggaagaaagtatagcagacatgga
aagtgcactggacattccagctatatcacacaccttgactggtctccagacaacaagtac
ataatgtctaactcgggagactatgagattctgtactgggacattccaaatggctgcaaa
ctaattaggaatcgatcagactgtaaggacatcgattggacgacatacacctgtgtgcta
ggctttcaagtctttggtgtctggccagaaggatctgatgggacagatatcaatgcactg
gtgcggtcccacaatagaaaggtgatagctgttgctgatgacttctgcaaagtccacctg
tttcagtatccctgctccaaagcaaaggctcccagtcacaagtacagtgcccacagcagc
catgtcaccaatgtcagttttactcataatgacagtcacctgatttcaactggtggaaaa
gacatgagcatcattcagtggaaacttgtggaaaagttatctttgcctcagaatgaggtt
gtagcggatactgcgctcaccaaagcccccgtctcttccattgaaagtgtcatgcagtct
gatgctcccgcaccacctccttcccagcccttaaatgagacagctgaagaagaaagcagg
ataagcagttctcccacacttctggagaacagcctggaacagactgtggggcccagcgca
gaccacagtgaggagcggagtgaggggggcagcgaagacctcggtgagcctgtttacgaa
gagccagcccgcgggatgagcgatgagcggagcgaaggcgccctccccggggaccagcag
gacccttcacccctgtcctaa

KEGG   Physeter catodon (sperm whale): 102988118
Entry
102988118         CDS       T06011                                 

Gene name
ALK
Definition
(RefSeq) ALK tyrosine kinase receptor
  KO
K05119  anaplastic lymphoma kinase [EC:2.7.10.1]
Organism
pcad  Physeter catodon (sperm whale)
Pathway
pcad05200  Pathways in cancer
pcad05223  Non-small cell lung cancer
pcad05235  PD-L1 expression and PD-1 checkpoint pathway in cancer
Brite
KEGG Orthology (KO) [BR:pcad00001]
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    102988118 (ALK)
   05235 PD-L1 expression and PD-1 checkpoint pathway in cancer
    102988118 (ALK)
  09162 Cancer: specific types
   05223 Non-small cell lung cancer
    102988118 (ALK)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01001 Protein kinases [BR:pcad01001]
    102988118 (ALK)
  09183 Protein families: signaling and cellular processes
   04090 CD molecules [BR:pcad04090]
    102988118 (ALK)
Enzymes [BR:pcad01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.10  Protein-tyrosine kinases
    2.7.10.1  receptor protein-tyrosine kinase
     102988118 (ALK)
Protein kinases [BR:pcad01001]
 Receptor tyrosine kinases (RTK)
  ALK family
   102988118 (ALK)
CD molecules [BR:pcad04090]
 Proteins
  102988118 (ALK)
SSDB
Motif
Pfam: PK_Tyr_Ser-Thr MAM Pkinase Gly_rich Ldl_recept_a Nup96
Other DBs
NCBI-GeneID: 102988118
NCBI-ProteinID: XP_028352394
UniProt: A0A455BTT6
LinkDB
Position
12
AA seq 1154 aa
MGAIGLLWLLLLLSPAASGSGSGTETGQRVGSPAMGSALQPREPLSYSRLQRKSLAVDFV
VPSLFRVYARDLLLPPPSPSETMAGRLEARGSLALDCAPLLRLVGPPPGASSPAPARART
LSRVLKGGSVRKLRRAKQLVLELGEEAILEGCVGPPEEATAGLLQFNLTELFSWWIRYGE
GRLRIRLMPEKKASEVGREGRLSAAIRASQPRLLFQIFATGTGHSSLELPTNLPSLPPDS
FAWNLTWIMKDSFPFLSHRSRYGLECSFDFPCELEYSPPLHNLGNQSWSWRRVPSEEASQ
MDLLDGPEEEHSKEMPRGAFLLLNTSVNSKHTILSPWMESSSEHCRLAVSVHRRPQPSGR
YVAQLLPHSEAGREIPLVPTPGKHGWTVLQGRIGRPENPFRVALEYISSGNRSLSAVDFF
ALKNCSEGTSPGSKMALQSSFTCWNGTVLQLGQACDFHRDCAQGEDEGQLCGKLPAGFYC
NFEDGFCGWTQSSLSPHTPQWQVRTLKDARFQDHQGHALLLSTTDAPTSESATVTSATFP
APMKNSPCELRMSWLIRGVLQGNVSLVLVENKTGKEQSRMIWHVATMEGLSLWQWTALPL
LDVADRFWLQIVAWWGQGSRATVAFNNISISLDCYLTIRGEDKMPQNTAPKSRNLFEGNP
NKEPKPWENTPKENPIFDPTVHWLFTTCGASGPHGPTQAQCNNAYRNSNLSVVVGSEGPL
KGIQTWKVPATDTYSISGYGAAGGKGGKNTMMRSHGVSVLGIFNLEKDDVLYILVGQQGE
DACPSPSDIAARNCLLTCPGPGRVAKIGDFGMARDIYRASYYRKGGCAMLPVKWMPPEAF
MEGIFTSKTDTWSFGVLLWEIFSLGYMPYPSKSNQEVLEFVTSGGRMDPPKNCPGPVYRI
MTQCWQHQPEDRPNFATILERIEYCTQDPDVINTALPIEYGPLVEEEEKVPMRPKDPEGI
PPLLVSAPPATRDEGREPAARTALPSASSGKAGKKPVAAEASARGARAPAVKGGHVNMAF
SQSNPPSELHQVQGSRNKPTSLWNPTYGSWFTEKPTKKSNPPAKKEQRDRGNLGGEGGCA
MPLPAAAGRRPGTSLLLEPSSLTASLRDVPLFRLRHFPCGTVHYGYQQQGFPPEAAAPGR
GRYEDPAAKSQPAP
NT seq 3465 nt   +upstreamnt  +downstreamnt
atgggagccatagggcttctgtggctgctgctgctgctttcaccggcagcctcaggctcc
gggagcgggaccgagaccggccagcgcgtgggctcaccagccatggggtcggcgctgcag
ccccgggagccgctcagctactcgcgcctgcagaggaagagcctggcggtggactttgtg
gtaccctctctctttcgcgtctatgctcgggacctgctgctgccgccgccgtccccttcg
gagacgatggccggccggctggaggcgcgcggctcgctggctcttgactgcgccccactg
cttaggctggtggggccaccacccggcgccagctctcccgccccggcccgggcacggacg
ctgtccagggtgctgaagggaggctcggttcgcaagctccggcgcgccaagcagctggtg
ctggagctgggagaggaggcgatccttgagggctgtgtagggcccccagaggaggcgact
gcggggctgctccagttcaacctcactgagctgttcagctggtggattcgctacggcgaa
ggacggctgaggatccgcctgatgcccgagaagaaggcgtcggaagtgggcagagaggga
aggctgtccgctgcgatccgcgcctcccagccccgccttctcttccagatcttcgcgacc
gggaccgggcatagctccttggagttaccaacaaacctgccttctcttcctcctgattct
tttgcctggaatctgacctggataatgaaagattccttcccattcctgtctcatcgcagc
cgatatggtctggagtgcagctttgacttcccctgtgagctggagtattcccctccacta
cacaaccttgggaaccagagctggtcctggcgccgtgtcccttccgaggaggcttcccag
atggacctgttggatggacccgaagaggagcactccaaggagatgcccagaggcgccttc
ctcctgctcaacacctcggtgaactccaagcacaccatcttgagtccatggatggagagc
agcagcgagcactgcaggctggccgtctcggtgcacaggcgcccgcagccctccgggagg
tacgtcgcccagctgctgccccacagtgaggctggaagagagatccccctggtacccact
ccaggaaagcatggttggactgtgctgcagggaagaattgggcgcccagagaacccgttc
cgagtggccctggaatacatctcgagtggaaaccgaagcttgtctgcagtggacttcttt
gccctgaagaactgcagcgaaggaacatccccgggctccaagatggccttgcagagttcc
ttcacttgctggaacgggacagtcctccagctcgggcaggcctgcgacttccaccgggac
tgtgcccagggagaagacgagggccagctgtgcggtaaactccctgctggtttttactgc
aacttcgaggatggattctgtggctggacccaaagctcactgtcaccccacacgccccag
tggcaagtcaggaccttaaaggatgcccggttccaggaccaccaaggccacgccctgttg
ctcagcaccactgatgcccccacctctgaaagtgctacggtgaccagcgctacgtttcct
gcaccgatgaagaactctccgtgcgagctccgaatgtcctggctcatccgtggagtcttg
cagggaaatgtctccttggtgctggtggagaacaaaaccgggaaggagcaaagcaggatg
atctggcatgttgccaccatggaaggcttgagcctgtggcagtggacggcgctgcctctc
cttgatgtggccgacaggttctggctgcagattgttgcgtggtggggacaaggatccaga
gccaccgtggctttcaacaatatctccatcagcctggactgctacctcaccattcgtggg
gaggacaagatgccgcagaatacagcacccaagtcaagaaatctgtttgagggaaaccca
aacaaggagccaaaaccctgggaaaacacaccaaaagagaaccccatctttgaccctaca
gttcactggctgttcaccacatgcggggccagtgggccccacggcccgacgcaggcccag
tgcaacaatgcctaccggaactccaacctgagtgtggtggtggggagcgagggccccctg
aagggcatccagacctggaaggtgccagccaccgacacctacagcatatcaggctacgga
gccgctggcgggaaaggcggtaagaacaccatgatgcgatcccacggcgtgtctgtgctg
ggcatcttcaacctggagaaggacgacgtgctgtacatcctggtcgggcagcagggggaa
gatgcctgccccagtcccagcgacattgctgccaggaactgcctcttgacctgtccaggc
cctggaagagtggccaagattggagacttcggaatggctcgagacatctaccgagcgagc
tactaccgaaagggaggctgtgcgatgctgccggtcaaatggatgcccccggaggccttc
atggaaggaatatttacttctaaaacagacacgtggtccttcggagtgcttctgtgggaa
atcttctctcttggatacatgccgtaccctagcaaaagcaaccaggaggttctggagttt
gtcaccagtggaggacggatggacccacctaagaactgccccgggcctgtataccggata
atgacccagtgctggcaacatcagcctgaagacaggcccaactttgccacaattttggag
aggattgaatactgcacccaggacccagatgtgatcaacactgctttgcccatagaatac
gggcccctcgtggaagaggaagagaaggtgcccatgaggcccaaggaccctgagggaatc
cctcctctgctggtctccgctcccccggccacgcgggatgagggccgcgagccggccgcc
cgcacggctctgccttccgcctcctcgggcaaagccggcaagaagcccgtggccgcagag
gcctctgcccgaggcgccagggcgccggccgtgaaggggggacacgttaacatggcattc
tctcagtccaacccgccctcggagctgcaccaagtccaggggtccagaaacaagcccacc
agcctatggaacccaacttacggctcctggttcacagagaaacccaccaaaaagagcaat
cctccggcgaagaaggagcagcgcgatagggggaacctgggcggcgagggcggctgtgcc
atgccgctccccgcggccgccggccgccggccgggcacctctctgctcctcgagccgtcc
tcgctgaccgccagcctgagggacgtgcctctgttcaggctgcgccacttcccgtgcggc
accgtccactacggctaccagcagcagggcttcccgcccgaggccgccgccccgggccgg
ggccgctacgaggaccccgcggccaagagccagcctgcgccctga

DBGET integrated database retrieval system