KEGG   Physeter catodon (sperm whale): 102983897
Entry
102983897         CDS       T06011                                 

Gene name
IL4
Definition
(RefSeq) interleukin-4
  KO
K05430  interleukin 4
Organism
pcad  Physeter catodon (sperm whale)
Pathway
pcad04060  Cytokine-cytokine receptor interaction
pcad04151  PI3K-Akt signaling pathway
pcad04630  JAK-STAT signaling pathway
pcad04640  Hematopoietic cell lineage
pcad04657  IL-17 signaling pathway
pcad04658  Th1 and Th2 cell differentiation
pcad04659  Th17 cell differentiation
pcad04660  T cell receptor signaling pathway
pcad04664  Fc epsilon RI signaling pathway
pcad04672  Intestinal immune network for IgA production
pcad05140  Leishmaniasis
pcad05200  Pathways in cancer
pcad05310  Asthma
pcad05320  Autoimmune thyroid disease
pcad05321  Inflammatory bowel disease
pcad05330  Allograft rejection
Brite
KEGG Orthology (KO) [BR:pcad00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04630 JAK-STAT signaling pathway
    102983897 (IL4)
   04151 PI3K-Akt signaling pathway
    102983897 (IL4)
  09133 Signaling molecules and interaction
   04060 Cytokine-cytokine receptor interaction
    102983897 (IL4)
 09150 Organismal Systems
  09151 Immune system
   04640 Hematopoietic cell lineage
    102983897 (IL4)
   04660 T cell receptor signaling pathway
    102983897 (IL4)
   04658 Th1 and Th2 cell differentiation
    102983897 (IL4)
   04659 Th17 cell differentiation
    102983897 (IL4)
   04657 IL-17 signaling pathway
    102983897 (IL4)
   04664 Fc epsilon RI signaling pathway
    102983897 (IL4)
   04672 Intestinal immune network for IgA production
    102983897 (IL4)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    102983897 (IL4)
  09163 Immune disease
   05310 Asthma
    102983897 (IL4)
   05320 Autoimmune thyroid disease
    102983897 (IL4)
   05321 Inflammatory bowel disease
    102983897 (IL4)
   05330 Allograft rejection
    102983897 (IL4)
  09174 Infectious disease: parasitic
   05140 Leishmaniasis
    102983897 (IL4)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04052 Cytokines and growth factors [BR:pcad04052]
    102983897 (IL4)
   00536 Glycosaminoglycan binding proteins [BR:pcad00536]
    102983897 (IL4)
Cytokines and growth factors [BR:pcad04052]
 Cytokines
  Interleukins
   102983897 (IL4)
Glycosaminoglycan binding proteins [BR:pcad00536]
 Heparan sulfate / Haparin
  Cytokines
   102983897 (IL4)
SSDB
Motif
Pfam: IL4
Other DBs
NCBI-GeneID: 102983897
NCBI-ProteinID: XP_007106325
UniProt: A0A2Y9EPJ1
LinkDB
Position
8
AA seq 133 aa
MGLTSQLIPMLVCLLACTSNFVYGHKGDITLQEIIKTLNILTARKNSCMELPVADVFATP
KNTTEKETFCRAATVLWHIYRYHKCLNNPLRGLHRNLSSMANMTCSVNEAKKSTLKDFLE
RLKTIMKEKYSKC
NT seq 402 nt   +upstreamnt  +downstreamnt
atgggtctcacctcccaactgatccccatgctagtctgcttactggcatgtaccagcaac
ttcgtctatggacacaagggtgatattaccttacaagagatcatcaaaacgctgaacatc
ctcacagcaagaaagaactcgtgcatggagctgcctgtagcagacgtctttgccacccca
aagaacacaaccgagaaggaaactttctgcagggccgcgactgtgctttggcatatctac
agataccacaagtgcttgaacaaccccctgaggggacttcacaggaacctcagcagcatg
gcaaacatgacctgttctgtgaatgaagccaagaagagtacgttgaaagacttcttggaa
aggctaaagacgattatgaaggagaaatactcaaagtgttga

DBGET integrated database retrieval system