KEGG   Physeter catodon (sperm whale): 102985179
Entry
102985179         CDS       T06011                                 

Gene name
CDK4
Definition
(RefSeq) cyclin-dependent kinase 4 isoform X1
  KO
K02089  cyclin-dependent kinase 4 [EC:2.7.11.22]
Organism
pcad  Physeter catodon (sperm whale)
Pathway
pcad01522  Endocrine resistance
pcad04110  Cell cycle
pcad04115  p53 signaling pathway
pcad04151  PI3K-Akt signaling pathway
pcad04218  Cellular senescence
pcad04530  Tight junction
pcad04660  T cell receptor signaling pathway
pcad04933  AGE-RAGE signaling pathway in diabetic complications
pcad04934  Cushing syndrome
pcad05160  Hepatitis C
pcad05162  Measles
pcad05163  Human cytomegalovirus infection
pcad05164  Influenza A
pcad05165  Human papillomavirus infection
pcad05166  Human T-cell leukemia virus 1 infection
pcad05167  Kaposi sarcoma-associated herpesvirus infection
pcad05169  Epstein-Barr virus infection
pcad05200  Pathways in cancer
pcad05203  Viral carcinogenesis
pcad05212  Pancreatic cancer
pcad05214  Glioma
pcad05218  Melanoma
pcad05219  Bladder cancer
pcad05220  Chronic myeloid leukemia
pcad05222  Small cell lung cancer
pcad05223  Non-small cell lung cancer
pcad05224  Breast cancer
pcad05225  Hepatocellular carcinoma
Brite
KEGG Orthology (KO) [BR:pcad00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04151 PI3K-Akt signaling pathway
    102985179 (CDK4)
 09140 Cellular Processes
  09143 Cell growth and death
   04110 Cell cycle
    102985179 (CDK4)
   04115 p53 signaling pathway
    102985179 (CDK4)
   04218 Cellular senescence
    102985179 (CDK4)
  09144 Cellular community - eukaryotes
   04530 Tight junction
    102985179 (CDK4)
 09150 Organismal Systems
  09151 Immune system
   04660 T cell receptor signaling pathway
    102985179 (CDK4)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    102985179 (CDK4)
   05203 Viral carcinogenesis
    102985179 (CDK4)
  09162 Cancer: specific types
   05212 Pancreatic cancer
    102985179 (CDK4)
   05225 Hepatocellular carcinoma
    102985179 (CDK4)
   05214 Glioma
    102985179 (CDK4)
   05220 Chronic myeloid leukemia
    102985179 (CDK4)
   05218 Melanoma
    102985179 (CDK4)
   05219 Bladder cancer
    102985179 (CDK4)
   05224 Breast cancer
    102985179 (CDK4)
   05222 Small cell lung cancer
    102985179 (CDK4)
   05223 Non-small cell lung cancer
    102985179 (CDK4)
  09167 Endocrine and metabolic disease
   04933 AGE-RAGE signaling pathway in diabetic complications
    102985179 (CDK4)
   04934 Cushing syndrome
    102985179 (CDK4)
  09172 Infectious disease: viral
   05166 Human T-cell leukemia virus 1 infection
    102985179 (CDK4)
   05160 Hepatitis C
    102985179 (CDK4)
   05164 Influenza A
    102985179 (CDK4)
   05162 Measles
    102985179 (CDK4)
   05163 Human cytomegalovirus infection
    102985179 (CDK4)
   05167 Kaposi sarcoma-associated herpesvirus infection
    102985179 (CDK4)
   05169 Epstein-Barr virus infection
    102985179 (CDK4)
   05165 Human papillomavirus infection
    102985179 (CDK4)
  09176 Drug resistance: antineoplastic
   01522 Endocrine resistance
    102985179 (CDK4)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01001 Protein kinases [BR:pcad01001]
    102985179 (CDK4)
Enzymes [BR:pcad01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.11  Protein-serine/threonine kinases
    2.7.11.22  cyclin-dependent kinase
     102985179 (CDK4)
Protein kinases [BR:pcad01001]
 Serine/threonine kinases: CMGC group
  CDK family
   102985179 (CDK4)
SSDB
Motif
Pfam: Pkinase PK_Tyr_Ser-Thr APH Kdo Kinase-like FTA2
Other DBs
NCBI-GeneID: 102985179
NCBI-ProteinID: XP_007116044
UniProt: A0A2Y9F705
LinkDB
Position
Unknown
AA seq 303 aa
MATPRYEPVAEIGVGAYGTVYKARDPHSGHFVALKSVRVPNGGGAGGGLPISTVREVALL
RRLEAFEHPNVVRLMDVCATARTDRETKVTLVFEHVDQDLRTYLDKAPPPGLPVETIKDL
MRQFLRGLDFLHANCIVHRDLKPENILVTSGGTVKLADFGLARIYSYQMALTPVVVTLWY
RAPEVLLQSTYATPVDMWSVGCIFAEMFRRKPLFCGNSEADQLGKIFDLIGLPPEDDWPR
DVSLPRGAFSPRGPRPVQSVVPEMEESGAQLLLEMLTFNPHKRISAFRALQHSYLHKAEG
NPE
NT seq 912 nt   +upstreamnt  +downstreamnt
atggctacccctcgatatgagccagtggctgagattggtgttggtgcctatgggacggtg
tataaggcccgtgatccccacagtggccactttgtggccctcaagagcgtaagagtcccc
aatggaggaggtgctggagggggcctgcccatcagcacagtccgtgaggtggctttactg
cggcggctggaggcttttgagcatcccaatgttgtgcggctgatggacgtctgtgccaca
gcccgaactgaccgggaaaccaaagtgaccctggtgtttgagcatgtggaccaagaccta
aggacatatctggacaaggcacccccgccaggcttgccagtggagaccatcaaggatctg
atgcgccagtttctaagaggcctagatttccttcatgccaactgcatcgttcatcgggat
ctgaagccagagaacattctggtgacaagtggtgggacagtcaagctggccgactttggc
ctggccagaatctacagctaccagatggcgcttacacctgtggtggttacactctggtac
cgtgctccagaagttcttttgcagtctacatatgcaacacctgtggacatgtggagtgtt
ggctgtatctttgcagagatgtttcgtcgaaagcctctcttctgtggaaactctgaagct
gaccagttaggcaaaatctttgacctgatcggactgcccccagaggatgactggccccga
gatgtgtctctaccccgaggagccttttcccccagagggccccgccccgtgcagtcggtg
gtacctgagatggaagagtctggagcacagctgctgctggagatgctgacttttaaccca
cacaagagaatctctgccttccgagccctgcagcactcttatctacataaggcagaaggt
aacccagagtga

KEGG   Physeter catodon (sperm whale): 102992532
Entry
102992532         CDS       T06011                                 

Gene name
CDK6
Definition
(RefSeq) cyclin-dependent kinase 6
  KO
K02091  cyclin-dependent kinase 6 [EC:2.7.11.22]
Organism
pcad  Physeter catodon (sperm whale)
Pathway
pcad04110  Cell cycle
pcad04115  p53 signaling pathway
pcad04151  PI3K-Akt signaling pathway
pcad04218  Cellular senescence
pcad04934  Cushing syndrome
pcad05160  Hepatitis C
pcad05162  Measles
pcad05163  Human cytomegalovirus infection
pcad05164  Influenza A
pcad05165  Human papillomavirus infection
pcad05167  Kaposi sarcoma-associated herpesvirus infection
pcad05169  Epstein-Barr virus infection
pcad05200  Pathways in cancer
pcad05203  Viral carcinogenesis
pcad05206  MicroRNAs in cancer
pcad05212  Pancreatic cancer
pcad05214  Glioma
pcad05218  Melanoma
pcad05220  Chronic myeloid leukemia
pcad05222  Small cell lung cancer
pcad05223  Non-small cell lung cancer
pcad05224  Breast cancer
pcad05225  Hepatocellular carcinoma
Brite
KEGG Orthology (KO) [BR:pcad00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04151 PI3K-Akt signaling pathway
    102992532 (CDK6)
 09140 Cellular Processes
  09143 Cell growth and death
   04110 Cell cycle
    102992532 (CDK6)
   04115 p53 signaling pathway
    102992532 (CDK6)
   04218 Cellular senescence
    102992532 (CDK6)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    102992532 (CDK6)
   05206 MicroRNAs in cancer
    102992532 (CDK6)
   05203 Viral carcinogenesis
    102992532 (CDK6)
  09162 Cancer: specific types
   05212 Pancreatic cancer
    102992532 (CDK6)
   05225 Hepatocellular carcinoma
    102992532 (CDK6)
   05214 Glioma
    102992532 (CDK6)
   05220 Chronic myeloid leukemia
    102992532 (CDK6)
   05218 Melanoma
    102992532 (CDK6)
   05224 Breast cancer
    102992532 (CDK6)
   05222 Small cell lung cancer
    102992532 (CDK6)
   05223 Non-small cell lung cancer
    102992532 (CDK6)
  09167 Endocrine and metabolic disease
   04934 Cushing syndrome
    102992532 (CDK6)
  09172 Infectious disease: viral
   05160 Hepatitis C
    102992532 (CDK6)
   05164 Influenza A
    102992532 (CDK6)
   05162 Measles
    102992532 (CDK6)
   05163 Human cytomegalovirus infection
    102992532 (CDK6)
   05167 Kaposi sarcoma-associated herpesvirus infection
    102992532 (CDK6)
   05169 Epstein-Barr virus infection
    102992532 (CDK6)
   05165 Human papillomavirus infection
    102992532 (CDK6)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01001 Protein kinases [BR:pcad01001]
    102992532 (CDK6)
Enzymes [BR:pcad01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.11  Protein-serine/threonine kinases
    2.7.11.22  cyclin-dependent kinase
     102992532 (CDK6)
Protein kinases [BR:pcad01001]
 Serine/threonine kinases: CMGC group
  CDK family
   102992532 (CDK6)
SSDB
Motif
Pfam: Pkinase PK_Tyr_Ser-Thr APH Kdo Kinase-like RIO1 FTA2
Other DBs
NCBI-GeneID: 102992532
NCBI-ProteinID: XP_023986514
UniProt: A0A2Y9TEJ3
LinkDB
Position
5
AA seq 326 aa
MEKDGLSRADQQYECVAEIGEGAYGKVFKARDLKNGGRFVALKRVRVQTGEEGMPLSTIR
EVAVLRHLETFEHPNVVRLFDVCTVSRTDRETKLTLVFEHVDQDLTTYLDKVPEPGVPTE
TIKDMMFQLLRGLDFLHSHRVVHRDLKPQNILVTSSGQIKLADFGLARIYSFQMALTSVV
VTLWYRAPEVLLQSSYATPVDLWSVGCIFAEMFRRKPLFRGSSDVDQLGKILDVIGLPGE
EDWPRDVALPRQAFHSKSPQPIEKFVTDIDEQGKDLLLKCLTFNPAKRISAYSALSHPYF
HDLERCKENLDSHLPPSQNSSEMNTA
NT seq 981 nt   +upstreamnt  +downstreamnt
atggagaaggacggcctgagccgtgcagaccagcagtacgaatgcgtggcggagatcggg
gagggcgcctatgggaaggtgttcaaggcccgggacctgaagaacggaggccgtttcgtg
gcgctgaagcgcgtgcgagtgcagaccggcgaggagggtatgccgctctctaccatccgc
gaggtggcggtgctgaggcacctggagaccttcgagcaccccaacgtggtcaggttgttt
gatgtgtgcacagtgtcacgaacagacagagaaaccaaactaacattagtgtttgaacat
gttgatcaagacttgaccacttatttggataaagttccagagcctggagtgcccactgaa
accataaaggatatgatgtttcagcttctccgaggtctggactttcttcattctcaccga
gtggtacatcgtgatctaaaaccacagaacattctggtgaccagcagtggacaaataaaa
ctggctgacttcggccttgcccgcatctacagttttcagatggctcttacctcagtggtc
gtcacgctgtggtacagagctccagaagtcttgcttcagtccagctacgccacccctgtg
gacctctggagtgttggttgcatatttgcagaaatgtttcgtagaaagccgctttttcgt
ggaagttcagatgttgatcaactaggaaaaatcttggacgtaattggactcccgggagaa
gaggactggcctagagatgttgccctccccaggcaggcttttcactcaaaatctcctcaa
ccaattgagaagtttgtaacagatattgatgaacaaggcaaagacctacttctgaagtgc
ttgacatttaatccagccaaaagaatatcggcctacagtgccctgtctcacccatacttc
cacgacctggagaggtgcaaggaaaacctggattcccacctgccgcccagccagaacagc
tcagaaatgaatacagcctga

DBGET integrated database retrieval system