KEGG   Physeter catodon (sperm whale): 102985437
Entry
102985437         CDS       T06011                                 

Gene name
TFRC
Definition
(RefSeq) transferrin receptor protein 1 isoform X1
  KO
K06503  transferrin receptor
Organism
pcad  Physeter catodon (sperm whale)
Pathway
pcad04066  HIF-1 signaling pathway
pcad04144  Endocytosis
pcad04145  Phagosome
pcad04216  Ferroptosis
pcad04640  Hematopoietic cell lineage
Brite
KEGG Orthology (KO) [BR:pcad00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04066 HIF-1 signaling pathway
    102985437 (TFRC)
 09140 Cellular Processes
  09141 Transport and catabolism
   04144 Endocytosis
    102985437 (TFRC)
   04145 Phagosome
    102985437 (TFRC)
  09143 Cell growth and death
   04216 Ferroptosis
    102985437 (TFRC)
 09150 Organismal Systems
  09151 Immune system
   04640 Hematopoietic cell lineage
    102985437 (TFRC)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01002 Peptidases and inhibitors [BR:pcad01002]
    102985437 (TFRC)
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:pcad04147]
    102985437 (TFRC)
   04090 CD molecules [BR:pcad04090]
    102985437 (TFRC)
Peptidases and inhibitors [BR:pcad01002]
 Metallo peptidases
  Family M28: aminopeptidase Y family
   102985437 (TFRC)
Exosome [BR:pcad04147]
 Exosomal proteins
  Exosomal proteins of haemopoietic cells  (B-cell, T-cell, DC-cell, reticulocyte, and mast cell)
   102985437 (TFRC)
  Exosomal proteins of colorectal cancer cells
   102985437 (TFRC)
CD molecules [BR:pcad04090]
 Proteins
  102985437 (TFRC)
SSDB
Motif
Pfam: Peptidase_M28 TFR_dimer PA
Other DBs
NCBI-GeneID: 102985437
NCBI-ProteinID: XP_007110543
UniProt: A0A2Y9EWS1
LinkDB
Position
1
AA seq 771 aa
MMDQARSALSNLFGGEPLSYTRFSLARQVDGDNSHVEMKLAVDEEENVDNNMRGNHTNVR
KPKRLNGYICYGTIAVIIFFLIGFMIGYLGYCKRVEPKADCERPAGTEPSCTEETEPFET
EEQLPETRRIFWADLKSMLSKRLDAIDFTSAIKMLNENSYVPREAGSQKDESLAFYIENQ
FRELKLSKAWHDEHFVKIQVKGSNAHNSVTIVNKSGSNSMVYQVENPEGYVAYSKATTVT
GKLVHANFGTKKDFEDLNMPVNGSLVIVRAGKITFAEKAANAESLNAIGVLIYMDQTKFP
IVNADLPVFGHAHLGTGDPYTPGFPSFNHTQFPPSQSSGLPNIPVQTISRAGAEKLFQNM
EGDCPSIWGIDSSCKLISSQNKNVKLTVNNVLKEIRIFNIFGVIKGFEEPDRYVIVGAQR
DAWGPGAAKSSVGTSLLLKLAQILSDMVLKGQFKPSRSIVFASWSGGDFGAIGATEWLEG
YLASLHLKAFTYINLDKAILGTSKFKVSSSPLLYSLIEKTMRDVKHPVTGLSLYRDSNWI
NKVEKLSFDNAAFPFLAYSGIPAVSFCFCEDTDYPYLGTPMDTYEVLNQNVPQLNKMARA
AAEVAGLLLIKLTHDVELNLNYEMYNDKILGFVREMNQFRADIKEMGLSLQWLYSARGDF
FRATSRLTTDYKNAERTNRFVMREINDRIMKVEYHFLSPYVSPRESPFRHIFWGSGSHTL
SALLEHLKLRQKNNGAFNQTLLKNQLALATWTIQGAANALSGDIWDIDNEF
NT seq 2316 nt   +upstreamnt  +downstreamnt
atgatggatcaagcaagatcagcattgtctaacttgtttggtggagaaccattgtcatat
acccggtttagtctggctcggcaagtagatggtgataacagtcatgtggagatgaaacta
gctgtagatgaagaagaaaatgttgacaataacatgaggggtaaccacaccaatgtcaga
aaaccaaaaaggttaaatggatatatctgctatgggactattgctgtaatcatctttttc
ttgattggatttatgattggctacttgggctactgtaaacgtgtagaaccaaaagccgat
tgtgagagaccggcaggaacagagccttcgtgcacagaggagacagaacctttcgaaaca
gaagagcagctccccgaaacacgtcgcatattttgggcagacctcaaatcaatgttgtcc
aagagactggatgccatagacttcaccagtgccatcaagatgctgaatgaaaattcttat
gtccctcgtgaggctggatctcaaaaagatgaaagccttgctttttacattgaaaatcag
ttccgtgaacttaaactcagcaaagcctggcatgatgaacattttgttaagattcaggtc
aaaggcagcaatgctcacaactcggtgaccatagtgaataagagcggcagcaacagtatg
gtgtaccaggtggagaatcccgagggttatgtggcgtatagtaaggctacgacagttact
ggtaaactggtccatgctaattttggcactaaaaaagactttgaggatttaaatatgcct
gtgaatggatctttagtgattgttagagcagggaaaattacttttgctgaaaaggctgca
aatgctgaaagtttaaatgcaattggtgtcttgatatacatggaccagactaaatttccc
attgttaatgcagatcttccagttttcggacatgctcatctgggaacaggtgacccttac
acacctggattcccttctttcaatcacactcagtttccaccatctcagtcatcaggattg
cctaacatacctgtccaaacaatttccagagctggtgcagaaaagctatttcaaaatatg
gaaggagactgtccttctatttggggaatagactcttcatgtaagctgatatcctcacag
aacaagaatgtgaagctcactgtgaacaatgtgctgaaagagataagaatttttaacatc
tttggagttattaagggctttgaagaaccagatcgctatgttatagtaggggcccagagg
gatgcctggggtcctggagctgcaaagtccagtgtaggaacaagtctactattgaaactt
gcccagatactttccgatatggtcttaaaaggtcagtttaaacccagcaggagcattgtc
tttgccagctggagtggtggagacttcggagctattggtgccactgaatggctagaggga
taccttgcctccttgcatttaaaagctttcacttacattaacctggataaagctattctt
ggtaccagcaagttcaaagtttcttccagcccactgttgtattcgcttattgagaagacg
atgcgagatgtgaaacatccagttactgggctctctctatatcgggacagcaactggatc
aacaaagtcgagaaactttcttttgataatgctgctttccccttccttgcatattctgga
atcccagcagtctctttctgtttttgtgaggacacagattacccttatttgggtactccc
atggatacctatgaggtactgaatcagaatgttcctcagttgaacaaaatggcacgtgca
gcagcagaagtagccggtctgcttttgattaaacttacccatgatgttgaattgaacctg
aactatgagatgtataatgacaaaatacttgggtttgtgagagaaatgaaccagttcaga
gcagacataaaggagatgggtctgagtctacagtggctgtattctgctcgtggagacttc
ttccgtgctacgtctagactaacaacagattataagaatgctgagagaacaaacagattt
gtcatgagggagatcaatgaccgtatcatgaaagtggaatatcacttcctgtcaccctac
gtatctccaagagagtctcctttccgacatatcttctggggctctggctctcacactctg
tcagctttactagagcacttgaagctgcggcagaaaaataacggtgcttttaatcaaaca
ctgttgaaaaaccagttggctctagcaacttggactattcagggagctgcaaatgccctc
tctggtgacatctgggacattgacaacgaattttaa

DBGET integrated database retrieval system