KEGG   Physeter catodon (sperm whale): 102985473
Entry
102985473         CDS       T06011                                 

Gene name
TSC2
Definition
(RefSeq) tuberin isoform X7
  KO
K07207  tuberous sclerosis 2
Organism
pcad  Physeter catodon (sperm whale)
Pathway
pcad04072  Phospholipase D signaling pathway
pcad04115  p53 signaling pathway
pcad04140  Autophagy - animal
pcad04150  mTOR signaling pathway
pcad04151  PI3K-Akt signaling pathway
pcad04152  AMPK signaling pathway
pcad04211  Longevity regulating pathway
pcad04218  Cellular senescence
pcad04714  Thermogenesis
pcad04910  Insulin signaling pathway
pcad04919  Thyroid hormone signaling pathway
pcad05163  Human cytomegalovirus infection
pcad05165  Human papillomavirus infection
pcad05168  Herpes simplex virus 1 infection
pcad05231  Choline metabolism in cancer
Brite
KEGG Orthology (KO) [BR:pcad00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04072 Phospholipase D signaling pathway
    102985473 (TSC2)
   04151 PI3K-Akt signaling pathway
    102985473 (TSC2)
   04152 AMPK signaling pathway
    102985473 (TSC2)
   04150 mTOR signaling pathway
    102985473 (TSC2)
 09140 Cellular Processes
  09141 Transport and catabolism
   04140 Autophagy - animal
    102985473 (TSC2)
  09143 Cell growth and death
   04115 p53 signaling pathway
    102985473 (TSC2)
   04218 Cellular senescence
    102985473 (TSC2)
 09150 Organismal Systems
  09152 Endocrine system
   04910 Insulin signaling pathway
    102985473 (TSC2)
   04919 Thyroid hormone signaling pathway
    102985473 (TSC2)
  09149 Aging
   04211 Longevity regulating pathway
    102985473 (TSC2)
  09159 Environmental adaptation
   04714 Thermogenesis
    102985473 (TSC2)
 09160 Human Diseases
  09161 Cancer: overview
   05231 Choline metabolism in cancer
    102985473 (TSC2)
  09172 Infectious disease: viral
   05168 Herpes simplex virus 1 infection
    102985473 (TSC2)
   05163 Human cytomegalovirus infection
    102985473 (TSC2)
   05165 Human papillomavirus infection
    102985473 (TSC2)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01009 Protein phosphatases and associated proteins [BR:pcad01009]
    102985473 (TSC2)
Protein phosphatases and associated proteins [BR:pcad01009]
 Protein serine/threonine phosphatases
  Phosphoprotein phosphatases (PPPs)
   Protein phosphatase-1
    PP1-interacting proteins (PIPs)
     102985473 (TSC2)
SSDB
Motif
Pfam: Tuberin DUF3384 Rap_GAP Telomere_reg-2 Cnd1
Other DBs
NCBI-GeneID: 102985473
NCBI-ProteinID: XP_007100133
UniProt: A0A2Y9EE39
LinkDB
Position
14
AA seq 1792 aa
MAKPASKDSGLKEKFKILLGLGTPRPNPRSAEGKQTEFIITAEILRELSVECGLNNRIRV
IGQICEVAKTKKFEEHAVEALWKAVSDLLQPERPPEARHAVLALLKAIVQGQGDRLGVLR
ALFFKVIKDYPSNEDLHERLEVFKALTDNGRHITYLEEELAEFVLQWMDIGLSSEFLLVL
VNLVKFNSCYLDEYIASMVHMICLLCVQTVSSVDIEVSLQVLDAVVCYNCLPAESLPLFI
VTLCRTINVKELCEPCWKLMRNLLGTHLGHSAIYHMCRIMEDRAYMEDAPLLRGAVFFVG
MALWGAHRLYSLKNSPTSVLPSFYEAMTCPNEVVSYEIVLSITRLIKKYRRELQAVTWDI
LLKIVERLLQQLQSLDSPELRAIVHDLLTTVEELCDQNEFHGSQERYFELVERCADQRPE
SSLLNLITYRAQSIHPAKDGWIHNLQLLMERFFRNELRSAVRIKVLDVLSFVLLINRQFY
EEELINLVVISQLSHVPEDKDHQVRKLATQLLVDLAEGCHTHHFNSLLDIIEKVIARSLS
PPPELEERDVVVYSASLEDVKTAVLGLLVILQTKLYALPASHATRVYETLVSHIQLHYKH
TYTLPIASSIRLQAFDFLLQLRADSLHRLGLPSKDGLVRFSPYCVCDYMEPERGSEKKAG
GPLSPPTGPPGPAPAVPAVRLGSLPYSLLFRVLLQCLKQETDWKVLKLVLSKLPESLRYK
VLIFTSPCNVDQLSAALCSMLSGPKTLERLRSTPEGFSRTDLHLAVVPVLTALISYHNYL
DKTRQREMVYCLEQGLIYRCASQCVVALAICSVEMPDIIIKALPVLVVKLTHISATASMA
IPLLEFLSTLARLPHLYRNFAAEQYASVFAISLPYTNPSKFNQYIVCLAHHVIAMWFIRC
RLPFRKDFVPYITKGLRSNVLLSFDDTPEKDSFRARSTSLNERPKSLRIARPPKQGLNNS
PPVKEFKESSAADAFRCRSISVSEHVVRSRIQTSLTSASLGSADENSMAQADDNLKNLHL
ELTETCLDMMARYVFSNFTAVPKRSPVGEFLLAGGRTKTWLVGNKLVTVTTSVGTGTRSL
LGLDSGELQGGPELSSDPSVHVRQTKEAPAKLESQAGQQVCRGARDRVRSMSGGHGLRVG
ALDAPASHFPGSPACLGSQTAPASKPEKASASTQLPAQKEKTNLAAYVPLLTQGWAEILV
RRPTGNTSWLMSLENPLSPFSSDINNTPLQELSNALMAAERFKERRDTALYKSLSVPAAG
SAKPPPPPRSNTDSAVVLEEGSPGEASLPVEPPELEDFEATLGTDGHYRHAEAFSRSSST
SSQEEKSFHAEELAAGGIPIERAVSSEGSRPSVELAFQPSQPLSKSSSSPELQTLQDILG
DPGDKADVGRLSPEAKARSQSGILDREGASWSAPGEESQGQGPTQPEGPLPSTCPRSPSG
LRPRGYTISDSAPSRRGKRVERDAFRSRAGTSNTEKVPGINPSFVFLQLYHSPFFGDESN
KPILLPNESFERSVQLLDQIPSYDTHKIAVLYVGEGQSNSELAILSNEHGSYRYTEFLTG
LGKLIELKDCQPDKVYLGGLDVCGEDGQFTYCWHDDIMQAVFHIATLMPTKDVDKHRCDK
KRHLGNDFVSIVYNDSGEDFKLGTIKGQFNFVHVIITPLDYECNLVSLQCRKDMEGLVDT
SMAKIVSDRNLPFVARQMALHANMASQVHHSRSNPTDTYPSKWIARLRHIKRLRHRIREE
AHYSNASLPLMQTHPPGHAKAPTQAPVEPTPTYETGQRKRLVSSVDDFTEFV
NT seq 5379 nt   +upstreamnt  +downstreamnt
atggccaagccagcaagcaaagattcaggcttgaaggagaagttcaagattctattggga
ctgggaactccaaggccaaatcccaggtctgcagagggcaaacagacggagtttatcatc
acggcggaaatcctgagagagctgagtgttgaatgtggcctcaacaatcgcatccgggtg
atagggcagatctgtgaggttgccaaaacgaagaaatttgaagagcacgcggtggaagca
ctctggaaggccgtctcagacttgctgcagccagagcggccgccagaggcccggcacgcg
gtgctggctctgctgaaggccatcgtgcaggggcagggggaccgcttgggcgttctcagg
gccctcttctttaaggtcatcaaggattacccctctaacgaagacctccacgagagactg
gaagttttcaaggccctcacggacaatgggagacacatcacctacttggaagaagagctg
gctgagtttgtcctgcagtggatggacatcggcctgtcctcagaatttcttctggtgctt
gtgaatttggtcaaattcaacagctgttacctcgatgaatacatcgcatccatggtccac
atgatctgcctgctgtgcgtccagaccgtgtcctccgtggacatagaggtctctctgcag
gtgctggatgccgtggtctgctacaactgcctgccggccgagagcctccccctgttcatt
gtcaccctctgccgcaccatcaatgtcaaggagctctgtgagccttgctggaagctgatg
cgcaatctcctgggcacccacctgggccacagcgccatctaccatatgtgccgcatcatg
gaggacagagcctacatggaagacgccccactgctgagaggagctgtgttctttgttggc
atggctctctggggagcccaccggctctactctctcaagaactccccaacatctgtgttg
ccgtcattttatgaggccatgacctgtccgaacgaggtggtgtcctatgagatcgtcctc
tccataaccagactcatcaagaagtaccggagggagctccaggccgtgacatgggacatc
ctgctgaagattgttgaacgcctacttcagcagctccagagcctggacagcccagagctc
agagccatcgtccacgacctgctgaccacggtggaagagctgtgtgatcaaaatgagttc
cacggctcgcaggagagatactttgagctcgttgagagatgtgcagaccagaggcctgag
tcctccctcttaaacttaataacctacagggctcagtcaatccatccagcaaaggatggc
tggattcacaacctgcagttactgatggagagatttttcaggaacgaattgcgcagcgct
gtgcgtatcaaggtgctggacgtcctgtccttcgtgctgctcatcaacaggcagttctat
gaggaggagctgatcaacttagtggtcatctcgcagctctcccatgtcccggaggataaa
gaccaccaagtccgaaagctggccacccagttgctggtagatctggctgaaggctgccac
acccaccactttaatagcctgctggacatcattgagaaggtgattgcccgctccctctct
ccaccccctgagctggaggaaagggatgtggtggtgtactcggcctccttggaggatgtg
aagactgcagtcctgggactcctggtcattcttcagaccaagctgtatgcccttcctgcc
agccacgccacacgtgtgtacgagacgcttgtcagccatatccagctccactacaagcac
acctacaccctgcccattgccagcagcatccggctgcaggctttcgacttcctcctgcag
ctgcgggctgactcgctgcaccgcctgggcctgcccagcaaggatgggcttgtgaggttc
agcccctactgcgtctgtgactacatggagccggagcggggctctgagaagaaggctggt
ggccccctgtcacctcccactgggccccctggcccggcacctgcagtccccgccgtgcgg
ctcggctcgctgccctactccctgctcttccgtgtcctgctgcagtgtttgaagcaggag
actgactggaaggtgctgaagctagtgctcagcaagctgcccgagtcgctgcgctacaag
gtcctcatcttcacctccccgtgtaatgttgaccagctatctgccgctctttgctccatg
ctttcaggtcccaagaccctcgagcggctccgaagcaccccagaagggttctccagaacc
gacctgcatctcgctgtggttcctgtgctgacagcattaatttcttaccataactacttg
gacaaaaccagacagcgggagatggtgtactgcctggagcaaggcctcatctaccgttgc
gccagccagtgcgtggtggccctggccatctgcagcgtggagatgcctgacatcatcatc
aaggcgctgcctgtcctggtcgtgaagctcacacacatctcagccacggccagcatggcc
attccactcctcgagttcctgtcgactctggccagactgcctcacctctacaggaacttc
gcagcagagcagtacgccagtgtgtttgccatctccctgccgtataccaacccctccaag
ttcaatcagtacattgtgtgcctggcccatcacgtcatagccatgtggttcattaggtgc
cgcctgcccttccggaaagattttgttccttatatcactaagggtctgcgctccaacgtt
ctcctgtcttttgatgacacccccgaaaaggacagctttagagcacggagcaccagtctc
aacgagaggcccaagagtttgaggatagccagaccccccaaacaaggcttgaataactct
ccacccgtgaaagaattcaaggagagctctgcagccgatgccttccggtgccgcagcatc
agtgtgtctgaacatgtggtccgcagcaggatccagacatctctcacgagtgccagcttg
gggtctgcagatgagaactcaatggcccaggctgacgacaacttgaaaaatctccacctg
gagctcacagagacgtgtctggacatgatggccagatacgtgttctccaacttcacggcg
gtccccaagaggtcccccgtgggagagttcctcctggcgggtggcaggaccaaaacctgg
ctggttgggaacaagcttgtcaccgtgacgacgagcgtggggactgggacccgatctctg
ctgggcctggactcaggagagctgcagggcggcccagagttgagctctgaccccagtgtg
cacgtgagacagacaaaggaggcaccagccaagctggagtcccaggccgggcaacaggtg
tgccgtggagcccgggaccgggtccgctccatgtctgggggccatggccttcgagttggt
gccttggatgctccagcctcccactttcctggcagccccgcttgcctgggctcacagact
gctccagccagcaagcccgagaaggcctcagccagcacccagctcccggcacagaaggag
aagacaaacctggcggcttacgtccccctgctgacccagggctgggcggagatcttggtc
cggagacccacagggaacaccagctggctgatgagcctggagaacccactcagtcccttc
tcctcggacatcaataacacgcccctgcaggagctgtcgaatgccctaatggccgccgag
cgcttcaaggagcgtcgcgacacagccctgtacaagtcgctgtcggtgccggcggccggc
tcagccaagccccccccacccccacgctctaacacagactctgcggtagttctggaggag
ggaagtccaggcgaggctagtttgccagtggagccccctgaactggaagactttgaggca
accctaggcacagacgggcactatcgacacgctgaagctttcagcaggtcatcttcgact
tccagccaggaggagaagtcgttccacgccgaggagttggctgctggggggatccccatc
gagcgggccgtctcctctgagggctcccggccctctgtggagctcgccttccagccctca
cagcccctgagcaagtcaagttcatcgcctgaactacagacgctgcaggacatccttggg
gaccctggggacaaggctgatgtcggccggctgagccctgaggccaaggcccggtcacag
tcagggatcctagacagggaaggtgcttcctggtcagccccaggcgaagagagccagggc
cagggtcccacccagcctgagggtcccttgccttccacctgtccccgctcccccagtggg
ctgcggcctcgaggctacactatctctgattcagccccgtcacgcaggggcaagagggtg
gagagggacgccttcaggagcagagctgggacctccaataccgagaaggtgccgggtatc
aaccccagctttgtgttcctgcagctctaccactcacctttcttcggtgatgagtccaac
aagccaatccttttgcccaatgagtcttttgagcggtcagtgcagcttcttgaccagatc
ccatcgtatgacacacacaagatcgccgtcctgtacgtgggagaaggccagagcaacagt
gagctcgccatcctgtccaatgagcacggctcctacaggtacacggagttcctgacgggg
ctgggcaagctcatcgagctcaaggactgccagccggacaaggtgtacctgggcggcctg
gacgtgtgcggcgaggacggccagttcacctactgctggcatgacgacatcatgcaagcc
gtcttccacatcgccaccctgatgcccaccaaggacgtggacaagcaccgctgtgacaag
aagcgccacctgggcaacgacttcgtgtccattgtctacaacgactctggcgaggacttc
aagctcggcaccatcaaaggccagttcaactttgtccacgtaatcatcaccccactggac
tatgagtgcaacctggtgtcgctgcagtgcaggaaagacatggagggcctcgtggacacc
agcatggccaagatcgtgtccgaccgaaacctgcccttcgtggcccgtcagatggccttg
cacgcaaatatggcctcgcaggtgcaccacagccgctccaaccccaccgacacctatccc
tccaagtggattgccaggctccgccacatcaagcggctccgccaccggatccgtgaggaa
gcccactactcaaacgccagcctgcccctgatgcagactcaccctcctggccatgccaag
gcccccacgcaggccccagttgagcccacgcccacctacgagacaggccagcggaagcgc
ctcgtctcctccgtggatgacttcactgagttcgtgtga

DBGET integrated database retrieval system