KEGG   Physeter catodon (sperm whale): 102985532
Entry
102985532         CDS       T06011                                 

Gene name
RPS6
Definition
(RefSeq) 40S ribosomal protein S6
  KO
K02991  small subunit ribosomal protein S6e
Organism
pcad  Physeter catodon (sperm whale)
Pathway
pcad01521  EGFR tyrosine kinase inhibitor resistance
pcad03010  Ribosome
pcad04066  HIF-1 signaling pathway
pcad04150  mTOR signaling pathway
pcad04151  PI3K-Akt signaling pathway
pcad04371  Apelin signaling pathway
pcad04714  Thermogenesis
pcad04910  Insulin signaling pathway
pcad05171  Coronavirus disease - COVID-19
pcad05205  Proteoglycans in cancer
Brite
KEGG Orthology (KO) [BR:pcad00001]
 09120 Genetic Information Processing
  09122 Translation
   03010 Ribosome
    102985532 (RPS6)
 09130 Environmental Information Processing
  09132 Signal transduction
   04371 Apelin signaling pathway
    102985532 (RPS6)
   04066 HIF-1 signaling pathway
    102985532 (RPS6)
   04151 PI3K-Akt signaling pathway
    102985532 (RPS6)
   04150 mTOR signaling pathway
    102985532 (RPS6)
 09150 Organismal Systems
  09152 Endocrine system
   04910 Insulin signaling pathway
    102985532 (RPS6)
  09159 Environmental adaptation
   04714 Thermogenesis
    102985532 (RPS6)
 09160 Human Diseases
  09161 Cancer: overview
   05205 Proteoglycans in cancer
    102985532 (RPS6)
  09172 Infectious disease: viral
   05171 Coronavirus disease - COVID-19
    102985532 (RPS6)
  09176 Drug resistance: antineoplastic
   01521 EGFR tyrosine kinase inhibitor resistance
    102985532 (RPS6)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03011 Ribosome [BR:pcad03011]
    102985532 (RPS6)
Ribosome [BR:pcad03011]
 Ribosomal proteins
  Eukaryotes
   Small subunit
    102985532 (RPS6)
  Archaea
    102985532 (RPS6)
SSDB
Motif
Pfam: Ribosomal_S6e Glyco_transf_52
Other DBs
NCBI-GeneID: 102985532
NCBI-ProteinID: XP_007110897
UniProt: A0A2Y9EXF9
LinkDB
Position
9
AA seq 249 aa
MKLNISFPATGCQKLIEVDDERKLRTFYEKRMATEVAADALGEEWKGYVVRISGGNDKQG
FPMKQGVLTHGRVRLLLSKGHSCYRPRRTGERKRKSVRGCIVDANLSVLNLVIVKKGEKD
IPGLTDTTVPRRLGPKRASRIRKLFNLSKEDDVRQYVVRKPLNKEGKKPRTKAPKIQRLV
TPRVLQHKRRRIALKKQHTKKNKEEAAEYAKLLAKRMKEAKEKRQEQIAKRRRLSSLRAS
TSKSESSQK
NT seq 750 nt   +upstreamnt  +downstreamnt
atgaagctgaacatctctttcccggccactggctgccagaaactcattgaagtggacgat
gaacgaaaacttcgtaccttttatgagaagcgtatggccacagaagttgctgctgacgct
ctgggtgaagaatggaagggttatgtggtccgaatcagtggtgggaacgacaaacagggt
ttccccatgaagcagggtgtcttgacccatggccgagtccgcctgctactgagtaagggg
cattcctgttacagaccaaggaggactggagaaagaaagcgcaaatctgtacggggttgc
attgtggatgccaatctgagtgttctcaatttggtcattgtaaaaaaaggggagaaggat
attccaggactcactgatactactgtgcctcgtcgcctgggacccaaaagagctagcaga
atccgcaaacttttcaatctctctaaagaagatgatgtccgccagtatgttgtgagaaag
cccctaaacaaagaaggtaagaaacctaggaccaaagcacccaagattcagcgtcttgtt
actccacgtgttctgcaacacaaacgtcggcgaattgctctgaagaaacagcatactaag
aaaaataaggaagaggctgcagaatatgctaaacttttggccaagagaatgaaggaggcc
aaagaaaaacgccaggaacagattgccaagagacggaggctgtcctctctgagagcttcc
acttctaagtctgagtccagtcaaaaatga

DBGET integrated database retrieval system