KEGG   Physeter catodon (sperm whale): 102985658
Entry
102985658         CDS       T06011                                 

Gene name
TP53
Definition
(RefSeq) cellular tumor antigen p53
  KO
K04451  tumor protein p53
Organism
pcad  Physeter catodon (sperm whale)
Pathway
pcad01522  Endocrine resistance
pcad01524  Platinum drug resistance
pcad04010  MAPK signaling pathway
pcad04071  Sphingolipid signaling pathway
pcad04110  Cell cycle
pcad04115  p53 signaling pathway
pcad04137  Mitophagy - animal
pcad04151  PI3K-Akt signaling pathway
pcad04210  Apoptosis
pcad04211  Longevity regulating pathway
pcad04216  Ferroptosis
pcad04218  Cellular senescence
pcad04310  Wnt signaling pathway
pcad04722  Neurotrophin signaling pathway
pcad04919  Thyroid hormone signaling pathway
pcad05012  Parkinson disease
pcad05014  Amyotrophic lateral sclerosis
pcad05016  Huntington disease
pcad05160  Hepatitis C
pcad05161  Hepatitis B
pcad05162  Measles
pcad05163  Human cytomegalovirus infection
pcad05165  Human papillomavirus infection
pcad05166  Human T-cell leukemia virus 1 infection
pcad05167  Kaposi sarcoma-associated herpesvirus infection
pcad05168  Herpes simplex virus 1 infection
pcad05169  Epstein-Barr virus infection
pcad05200  Pathways in cancer
pcad05202  Transcriptional misregulation in cancer
pcad05203  Viral carcinogenesis
pcad05205  Proteoglycans in cancer
pcad05206  MicroRNAs in cancer
pcad05210  Colorectal cancer
pcad05212  Pancreatic cancer
pcad05213  Endometrial cancer
pcad05214  Glioma
pcad05215  Prostate cancer
pcad05216  Thyroid cancer
pcad05217  Basal cell carcinoma
pcad05218  Melanoma
pcad05219  Bladder cancer
pcad05220  Chronic myeloid leukemia
pcad05222  Small cell lung cancer
pcad05223  Non-small cell lung cancer
pcad05224  Breast cancer
pcad05225  Hepatocellular carcinoma
pcad05226  Gastric cancer
pcad05230  Central carbon metabolism in cancer
pcad05418  Fluid shear stress and atherosclerosis
Brite
KEGG Orthology (KO) [BR:pcad00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04010 MAPK signaling pathway
    102985658 (TP53)
   04310 Wnt signaling pathway
    102985658 (TP53)
   04071 Sphingolipid signaling pathway
    102985658 (TP53)
   04151 PI3K-Akt signaling pathway
    102985658 (TP53)
 09140 Cellular Processes
  09141 Transport and catabolism
   04137 Mitophagy - animal
    102985658 (TP53)
  09143 Cell growth and death
   04110 Cell cycle
    102985658 (TP53)
   04210 Apoptosis
    102985658 (TP53)
   04216 Ferroptosis
    102985658 (TP53)
   04115 p53 signaling pathway
    102985658 (TP53)
   04218 Cellular senescence
    102985658 (TP53)
 09150 Organismal Systems
  09152 Endocrine system
   04919 Thyroid hormone signaling pathway
    102985658 (TP53)
  09156 Nervous system
   04722 Neurotrophin signaling pathway
    102985658 (TP53)
  09149 Aging
   04211 Longevity regulating pathway
    102985658 (TP53)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    102985658 (TP53)
   05202 Transcriptional misregulation in cancer
    102985658 (TP53)
   05206 MicroRNAs in cancer
    102985658 (TP53)
   05205 Proteoglycans in cancer
    102985658 (TP53)
   05203 Viral carcinogenesis
    102985658 (TP53)
   05230 Central carbon metabolism in cancer
    102985658 (TP53)
  09162 Cancer: specific types
   05210 Colorectal cancer
    102985658 (TP53)
   05212 Pancreatic cancer
    102985658 (TP53)
   05225 Hepatocellular carcinoma
    102985658 (TP53)
   05226 Gastric cancer
    102985658 (TP53)
   05214 Glioma
    102985658 (TP53)
   05216 Thyroid cancer
    102985658 (TP53)
   05220 Chronic myeloid leukemia
    102985658 (TP53)
   05217 Basal cell carcinoma
    102985658 (TP53)
   05218 Melanoma
    102985658 (TP53)
   05219 Bladder cancer
    102985658 (TP53)
   05215 Prostate cancer
    102985658 (TP53)
   05213 Endometrial cancer
    102985658 (TP53)
   05224 Breast cancer
    102985658 (TP53)
   05222 Small cell lung cancer
    102985658 (TP53)
   05223 Non-small cell lung cancer
    102985658 (TP53)
  09164 Neurodegenerative disease
   05012 Parkinson disease
    102985658 (TP53)
   05014 Amyotrophic lateral sclerosis
    102985658 (TP53)
   05016 Huntington disease
    102985658 (TP53)
  09166 Cardiovascular disease
   05418 Fluid shear stress and atherosclerosis
    102985658 (TP53)
  09172 Infectious disease: viral
   05166 Human T-cell leukemia virus 1 infection
    102985658 (TP53)
   05161 Hepatitis B
    102985658 (TP53)
   05160 Hepatitis C
    102985658 (TP53)
   05162 Measles
    102985658 (TP53)
   05168 Herpes simplex virus 1 infection
    102985658 (TP53)
   05163 Human cytomegalovirus infection
    102985658 (TP53)
   05167 Kaposi sarcoma-associated herpesvirus infection
    102985658 (TP53)
   05169 Epstein-Barr virus infection
    102985658 (TP53)
   05165 Human papillomavirus infection
    102985658 (TP53)
  09176 Drug resistance: antineoplastic
   01524 Platinum drug resistance
    102985658 (TP53)
   01522 Endocrine resistance
    102985658 (TP53)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03000 Transcription factors [BR:pcad03000]
    102985658 (TP53)
   03036 Chromosome and associated proteins [BR:pcad03036]
    102985658 (TP53)
   03400 DNA repair and recombination proteins [BR:pcad03400]
    102985658 (TP53)
Transcription factors [BR:pcad03000]
 Eukaryotic type
  beta-Scaffold factors with minor groove contacts
   p53
    102985658 (TP53)
Chromosome and associated proteins [BR:pcad03036]
 Eukaryotic type
  Sister chromatid separation proteins
   Aurora kinases
    Regulators of Aurora kinases
     102985658 (TP53)
DNA repair and recombination proteins [BR:pcad03400]
 Eukaryotic type
  Check point factors
   Other check point factors
    102985658 (TP53)
SSDB
Motif
Pfam: P53 P53_tetramer P53_TAD TAD2 CEP1-DNA_bind
Other DBs
NCBI-GeneID: 102985658
NCBI-ProteinID: XP_028355209
UniProt: A0A455C1G1
LinkDB
Position
14
AA seq 387 aa
MEESQAELGVEPPLSQETFSDLWKLLPENNLLSSELSPAVDDLLLSPEDVANWLDERPDE
APQMPESPAPAAPAPAAPAPATSWPLSSFVPSQKTYPGSYEFRLGFLHSGTAKSVTCTYS
PALNKLFCQLAKTCPVQLWVSSPPPPGTRVRAMAIYKKSEYMTEVVRRCPHHERCSDYSD
GLAPPQHLIRVEGNLRAEYLDDRNTFRHSVVVPYEPPEVGSDCTTIHYNFMCNSSCMGGM
NRRPILTIITLEDSNGNLLGRNSFEVRVCACPGRDRRTEEENFRKKGQSCPEPPPGSAKR
ALPTSTSSSPPQKKKPLDGEYFTLQIRGRERFEMFRELNEALELKDAQAGKEPGESRAHS
SHLKSKKGQSPSRHKKLMFKREGPDSD
NT seq 1164 nt   +upstreamnt  +downstreamnt
atggaggagtcgcaggcagaactcggcgtggagccccctctgagtcaggagacgttttca
gacttgtggaaactgcttcctgaaaacaaccttctgtcctctgagctctccccggccgtg
gatgacctgctgctgtccccagaagacgtcgcaaactggctggatgaacgtccagatgaa
gccccacaaatgccagagtctcctgcgccagctgcccccgccccagccgccccagcacca
gccacctcctggcccctgtcgtcctttgtcccttcccagaagacctaccctggcagctat
gagttccgtctaggtttcctacattctggaacagccaagtctgtaacctgcacgtattcc
cctgccctcaacaagctgttttgccagctggccaagacctgcccggtgcagctgtgggtc
agctcaccacccccgcccggcacccgggtccgcgccatggccatctacaagaagtcagag
tacatgacggaggttgtgaggcgctgtccccaccacgagcgctgctctgactatagcgac
ggtctggcccctcctcagcatctcatccgggtggaagggaatttacgtgctgagtatttg
gacgacagaaacacttttcgacacagcgtggtggtgccctacgagccgcccgaggttggc
tctgactgtaccaccatccactacaacttcatgtgtaacagctcctgcatggggggcatg
aaccggcggcccatcctcaccatcatcacactggaagactccaatggtaacctgctggga
cggaacagctttgaggtgcgtgtttgtgcctgtcctgggagagaccgccgcacagaggaa
gaaaatttccgcaagaaggggcagtcttgccctgagccgccccctgggagcgctaagcga
gcactgcctaccagcaccagctcctctccaccgcaaaagaagaaaccactggatggagaa
tatttcactcttcagatccgtgggcgtgaacgctttgagatgttccgagagctgaatgag
gccttggagctgaaggatgctcaggctggaaaagagccaggggaaagcagggctcactct
agccacctgaagtctaagaaggggcagtctccgtctcgccataaaaaactgatgttcaag
agagaagggcctgactcagactga

DBGET integrated database retrieval system