KEGG   Physeter catodon (sperm whale): 102985806
Entry
102985806         CDS       T06011                                 

Gene name
NOS3
Definition
(RefSeq) nitric oxide synthase, endothelial isoform X2
  KO
K13242  nitric-oxide synthase, endothelial [EC:1.14.13.39]
Organism
pcad  Physeter catodon (sperm whale)
Pathway
pcad00220  Arginine biosynthesis
pcad00330  Arginine and proline metabolism
pcad01100  Metabolic pathways
pcad04020  Calcium signaling pathway
pcad04022  cGMP-PKG signaling pathway
pcad04066  HIF-1 signaling pathway
pcad04071  Sphingolipid signaling pathway
pcad04151  PI3K-Akt signaling pathway
pcad04370  VEGF signaling pathway
pcad04371  Apelin signaling pathway
pcad04611  Platelet activation
pcad04915  Estrogen signaling pathway
pcad04921  Oxytocin signaling pathway
pcad04926  Relaxin signaling pathway
pcad04931  Insulin resistance
pcad04933  AGE-RAGE signaling pathway in diabetic complications
pcad05418  Fluid shear stress and atherosclerosis
Brite
KEGG Orthology (KO) [BR:pcad00001]
 09100 Metabolism
  09105 Amino acid metabolism
   00220 Arginine biosynthesis
    102985806 (NOS3)
   00330 Arginine and proline metabolism
    102985806 (NOS3)
 09130 Environmental Information Processing
  09132 Signal transduction
   04370 VEGF signaling pathway
    102985806 (NOS3)
   04371 Apelin signaling pathway
    102985806 (NOS3)
   04066 HIF-1 signaling pathway
    102985806 (NOS3)
   04020 Calcium signaling pathway
    102985806 (NOS3)
   04071 Sphingolipid signaling pathway
    102985806 (NOS3)
   04022 cGMP-PKG signaling pathway
    102985806 (NOS3)
   04151 PI3K-Akt signaling pathway
    102985806 (NOS3)
 09150 Organismal Systems
  09151 Immune system
   04611 Platelet activation
    102985806 (NOS3)
  09152 Endocrine system
   04915 Estrogen signaling pathway
    102985806 (NOS3)
   04921 Oxytocin signaling pathway
    102985806 (NOS3)
   04926 Relaxin signaling pathway
    102985806 (NOS3)
 09160 Human Diseases
  09166 Cardiovascular disease
   05418 Fluid shear stress and atherosclerosis
    102985806 (NOS3)
  09167 Endocrine and metabolic disease
   04931 Insulin resistance
    102985806 (NOS3)
   04933 AGE-RAGE signaling pathway in diabetic complications
    102985806 (NOS3)
Enzymes [BR:pcad01000]
 1. Oxidoreductases
  1.14  Acting on paired donors, with incorporation or reduction of molecular oxygen
   1.14.13  With NADH or NADPH as one donor, and incorporation of one atom of oxygen into the other donor
    1.14.13.39  nitric-oxide synthase (NADPH)
     102985806 (NOS3)
SSDB
Motif
Pfam: NO_synthase FAD_binding_1 Flavodoxin_1 NAD_binding_1 HTH_15 DEC-1_N
Other DBs
NCBI-GeneID: 102985806
NCBI-ProteinID: XP_007126716
UniProt: A0A2Y9FMB5
LinkDB
Position
5
AA seq 1205 aa
MGNLKSVGQEPGPPCGLGLGLGLGLCSKQGPASPAPEPSRAPAPAPPPAPDHSPAPNSPQ
LTRPPEGPRFPRVKNWEVGTIAYDTLCAQSQQDGPCTPRRCLGSLVFPRKLQSRPSQGPP
PPEQLLSQARDFINQYYSSIKRSGSEAHKERLQEVEAEVAATGTYQLRESELVFGAKQAW
RNAPRCVGRIQWGKLQVFDARDCSSAQEMFTYVCNHIKYATNRGNLRSAITVFPQRAPGR
GDFRIWNSQLVRYAGYRQQDGSVRGDPANVEITELCIQHGWTPGNGRFDVLPLLLQTPDE
APELFVLPPELVLEVPLEHPTLEWFSALGLRWYALPAVSNMLLEIGGLEFPAAPFSGWYM
STEIGTRNLCDPHRYNILEDVAVCMDLDTRTTSSLWKDKAAVEINLAVLHSYQLAKVAIV
DHHAATASFMKHLENEQRARGGCPADWAWIVPPISGSLTPVFHQEMVNYVLSPAFRYQPD
PWKGSAAKGASITRKKTFKEVANAVKISASLMGTVMAKRVKATILYASETGRAQSYAQQL
GRLFRKAFDPRVLCMDEYDVVSLEHETLVLVVTSTFGNGDPPENGESFAAALMEMSGPYN
SSPRPEQHKSYKIRFNSVSCSDPLVSSWRRKRKESSNTDSAGALGTLRFCVFGLGSRAYP
HFCAFARAVDTRLEELGGERLLQLGQGDELCGQEEAFRGWAQAAFQASCETFCVGEDAKA
AAQDIFSPKRSWKRQRYRLSAQAEGLQLLPGLIHAHRRKMFQATVLLVENLQSSKSTRAT
ILVRLDTGGQEGLQYQPGDHIGICPPNRPGLVEALMSRVEDPPPPTESVAVEQLEKGSPG
GPPPGWVRDPRLPPCTLRQALTFFLDITSPPSPQLLRLLSTLAEEPSEQQELETLSQDPR
RYEEWKWFRCPTLLEALEQFPSVALPAPLLLTQLPLLQPRYYSVSSAPSAHPGEVHLTVA
VLAYRTQDGLGPLHYGVCSTWLSQLKTGDPVPCFIRGAPSFRLPPDPSLPCILVGPGTGI
APFRGFWQERLHDIESKGLQPAPMTLVFGCRCSQLDHLYREEVQDAQQRGVFGRVLTAFS
REPDSPKTYVQDVLRTELAAEVHRVLCLERGHMFVCGDVTMATSVLQTVQRILATEGDME
LDEAGDVIGVLRDQQRYHEDIFGLTLRTQEVTSRIRTQSFSLQERHMRGAVPWAFDPPGP
DTPGP
NT seq 3618 nt   +upstreamnt  +downstreamnt
atgggcaacttgaagagcgtgggccaggagcctgggccaccctgcggcctggggctaggg
ctgggcctcgggctgtgcagcaagcagggcccggcctccccagcacccgagcccagccgg
gcaccggcacccgcacccccgcccgcgccagaccacagcccggctcccaacagcccacag
ctaacccggcctccagaggggcccaggttccctcgtgtgaagaattgggaggtggggacc
atcgcctacgacactctgtgtgcgcagtcacagcaggacgggccctgcacccccagacgc
tgcctgggctccctggtgtttccacggaaactgcagagccgaccctcccagggccctcca
ccccctgagcagctgctgagccaggccagggacttcatcaaccagtactacagctccatc
aagaggagcggctccgaggctcacaaggagcgccttcaggaagtggaagccgaggtagcg
gccacgggcacctaccagcttcgtgagagcgagctggtgttcggggccaagcaggcctgg
cgcaacgccccccgctgcgtgggccggatccagtgggggaagctgcaggtgtttgatgca
cgggactgcagctctgcgcaggagatgttcacctacgtctgcaaccacatcaagtacgcc
accaaccggggcaacctgcgttcggccattacagtgttcccccagcgcgccccgggccgc
ggagacttccgaatctggaacagccagctggtgcgctacgcgggctacaggcagcaggac
ggctccgtgcggggggaccccgccaacgtggagatcaccgagctctgcatccagcacggc
tggacgcccggaaacggccgctttgatgtgctgcccctgctgctccagaccccagacgag
gccccagaactcttcgttctgcctcccgaactggtcctcgaggtgcccctggagcacccc
acgctggagtggttctcggccctgggcctgcgctggtacgccctcccagcagtgtccaat
atgctgctggaaattgggggcctggagttccctgcagcccccttcagcggctggtacatg
agcacggagattggcacgcggaacctgtgtgatcctcaccgctacaacatcctggaggat
gtggccgtctgcatggacctggacacccggaccacctcatccctgtggaaagacaaggca
gccgtggaaatcaacttggctgtgctgcacagttaccagctcgccaaagtggccatcgtg
gaccaccacgctgccacagcctccttcatgaagcacctggagaacgagcagagagccagg
gggggctgccctgccgactgggcctggatcgtgccccccatctcgggcagcctcaccccc
gtcttccatcaggagatggtcaactatgtcctgtcccctgctttccgctaccagccagac
ccctggaaggggagcgcggccaagggcgccagcatcaccaggaagaagacctttaaggaa
gtggccaacgcggtgaagatctctgcctcactcatgggcaccgtgatggcgaagcgagtg
aaggcgacaattctgtacgcctccgagaccggccgggcccagagctacgcacagcagctg
gggaggctcttccggaaggccttcgaccctcgggtcctgtgcatggatgagtatgacgtg
gtgtccctggagcacgagactctggtgttggtggtgaccagcacctttgggaacggcgat
cccccagagaacggagagagttttgcagcagccctgatggagatgtcgggcccctacaac
agctcccctcggccagaacaacacaagagttacaaaatccgcttcaacagcgtctcctgc
tcagacccgctggtgtcctcctggcggcggaagaggaaggagtccagtaatacggacagc
gcaggggcgctggggaccctcaggttctgtgtgtttgggctgggctcccgggcgtacccc
catttctgcgcctttgctcgtgcggtggacacgcggctggaagagctgggaggggagcgg
ctgcttcagctgggccagggcgatgagctgtgcggccaggaggaggccttccgcggctgg
gcccaggctgccttccaggcctcctgtgagacgttctgcgtgggggaggacgccaaggcc
gcggcccaggacatcttcagccccaaacggagctggaaacgccagaggtaccggctgagc
gcccaggccgagggcctccagctgctgccaggcctgatccacgcacacaggcggaagatg
ttccaggcgacagtcctcttggtggaaaacctgcagagcagcaagtccacccgggccacg
atcctggtgcgcctggacactggaggccaggaggggctccagtaccagccgggggaccac
ataggcatctgcccgcccaaccggccggggctcgtggaggcgctgatgagccgcgtggag
gacccgccgccgcccaccgagtctgtggcagtggagcagctggagaagggcagcccaggt
ggccctcctcccggctgggtacgggacccccggctgccgccgtgtacgctgcgccaggct
ctcacctttttcctggacatcacctccccgcccagccctcaacttcttcgactgctcagc
accctggctgaagagcccagtgaacagcaggaactcgagaccctcagccaggacccccgg
cgctacgaggagtggaagtggttccgctgccccaccctgctggaggcgctcgagcagttt
ccatccgtggcgctgcctgccccgctcctcctcacccagctgcccctgctccagccccgg
tactactcggtcagctcagcacccagcgcccatccaggagaggtccacctcacagtagct
gtgctggcatacaggacccaagatgggctgggccccctgcactatggagtctgctccaca
tggctgagccagctcaagactggagaccccgtaccctgcttcatcaggggggctccctcc
ttccggctgccgcctgatcccagcctgccctgcatcctcgtgggcccgggcactggcatc
gcccccttccggggattttggcaggagcggctacacgacatcgagagcaaagggctgcag
cccgcccccatgaccttggtgttcggctgccggtgctcccagctcgaccacctctaccgc
gaggaggtgcaggatgcccagcagcgcggcgtgtttggccgcgtcctcaccgccttctcc
cgggaacccgacagccctaagacctacgtgcaggacgtcctgcggacggagctggctgct
gaggtgcaccgcgtgctgtgcctcgagcggggccacatgtttgtctgcggcgatgtcacc
atggcaaccagcgtcctgcagacggtgcagcgcatcttggcgacagagggcgacatggag
ctggatgaggccggcgacgtcatcggcgtgctgcgggatcagcaacgctatcacgaggac
attttcgggctcacgctgcgcacccaggaggtgacaagccgcatacgcacccagagcttt
tccttgcaggagcggcatatgcggggcgcagtgccctgggcgttcgacccgcccggccca
gacacccctggcccctga

DBGET integrated database retrieval system