KEGG   Physeter catodon (sperm whale): 102985832
Entry
102985832         CDS       T06011                                 

Gene name
RARB
Definition
(RefSeq) retinoic acid receptor beta isoform X1
  KO
K08528  retinoic acid receptor beta
Organism
pcad  Physeter catodon (sperm whale)
Pathway
pcad05200  Pathways in cancer
pcad05222  Small cell lung cancer
pcad05223  Non-small cell lung cancer
pcad05226  Gastric cancer
Brite
KEGG Orthology (KO) [BR:pcad00001]
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    102985832 (RARB)
  09162 Cancer: specific types
   05226 Gastric cancer
    102985832 (RARB)
   05222 Small cell lung cancer
    102985832 (RARB)
   05223 Non-small cell lung cancer
    102985832 (RARB)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03000 Transcription factors [BR:pcad03000]
    102985832 (RARB)
  09183 Protein families: signaling and cellular processes
   03310 Nuclear receptors [BR:pcad03310]
    102985832 (RARB)
Transcription factors [BR:pcad03000]
 Eukaryotic type
  Zinc finger
   Cys4 thyroid hormone receptor-like
    102985832 (RARB)
Nuclear receptors [BR:pcad03310]
 1. Thyroid hormone like
  1B. Retinoic acid receptor (RAR)
   102985832 (RARB)
SSDB
Motif
Pfam: zf-C4 Hormone_recep
Other DBs
NCBI-GeneID: 102985832
NCBI-ProteinID: XP_007114465
UniProt: A0A2Y9F4J2
LinkDB
Position
1
AA seq 448 aa
MFDCMDVLSVSPGQILDFYTASPSSCMLQEKALKACFSGLTQTEWQHRHTAQSIETQSTS
SEELVPSPPSPLPPPRVYKPCFVCQDKSSGYHYGVSACEGCKGFFRRSIQKNMIYTCHRD
KNCVINKVTRNRCQYCRLQKCFEVGMSKESVRNDRNKKKKEPSKQECTESYEMTAELDDL
TEKIRKAHQETFPSLCQLGKYTTNSSADHRVRLDLGLWDKFSELATKCIIKIVEFAKRLP
GFTGLTIADQITLLKAACLDILILRICTRYTPEQDTMTFSDGLTLNRTQMHNAGFGPLTD
LVFTFAGQLLPLEMDDTETGLLSAICLICGDRQDLEEPTKVDKLQEPLLEALKIYIRKRR
PSKPHMFPKILMKITDLRSISAKGAERVITLKMEIPGSMPPLIQEMLENSEGHEPLTPSS
SGNTAEHSPSTSPSSVENSGIGQSPLLQ
NT seq 1347 nt   +upstreamnt  +downstreamnt
atgtttgactgtatggatgtcctgtcagtgagtcctgggcaaatcctggatttctacact
gcgagcccgtcttcctgcatgctccaggagaaagctctcaaagcatgcttcagtggattg
acccaaaccgaatggcagcatcggcacactgcgcaatcgattgaaacacagagcaccagc
tccgaggaactggtcccgagccctccgtctccacttcctccccctcgagtgtacaagccc
tgcttcgtctgccaggacaagtcatcggggtaccactatggagtcagcgcctgcgagggg
tgtaaggggtttttccgcagaagtattcagaagaacatgatttacacttgtcaccgagat
aagaactgtgttattaataaagtcaccaggaatcgatgccagtactgtcgactccagaag
tgctttgaagtgggaatgtccaaagaatcggtcaggaatgacagaaacaagaaaaagaag
gagccttcgaagcaggaatgcacggagagctacgaaatgacggccgagctggacgatctc
acggagaagatccggaaagcccaccaggaaaccttcccctcgctctgccagctgggcaag
tacaccacgaattccagtgctgaccatcgagtccgactggatctgggcctctgggacaaa
ttcagtgaactggctaccaagtgcattattaagatcgtggagtttgctaaacgtctgcca
ggcttcaccggcttgaccatcgcagaccaaatcaccctgctgaaggcggcctgtttggac
atcctgattctgagaatctgcaccaggtataccccagagcaagacaccatgacgttttcg
gatggcctgaccctgaatcgaacccagatgcacaacgctgggtttggccccctgaccgac
ctcgtgttcaccttcgccggccagcttctgcctctggagatggacgacacggagacaggc
cttctcagcgccatctgcttgatctgtggagaccgtcaggaccttgaggaaccaacaaaa
gtagataagctacaagaaccattgctggaagcactaaaaatttatatcagaaagagacga
cccagcaagcctcatatgtttccaaagatcctcatgaaaatcacagatctccgcagcatc
agcgctaaaggtgcagaacgtgtaattaccttgaaaatggaaattcctggctcgatgccc
cctctcattcaggaaatgctggagaattctgaaggacatgaacccttgaccccaagctcg
agtgggaacacagcagagcacagtcccagcacctcgcccagctccgtggagaacagtggt
atcggtcagtcaccactgctgcaataa

DBGET integrated database retrieval system