KEGG   Physeter catodon (sperm whale): 102986517
Entry
102986517         CDS       T06011                                 

Gene name
SMAD4
Definition
(RefSeq) mothers against decapentaplegic homolog 4
  KO
K04501  mothers against decapentaplegic homolog 4
Organism
pcad  Physeter catodon (sperm whale)
Pathway
pcad04068  FoxO signaling pathway
pcad04110  Cell cycle
pcad04310  Wnt signaling pathway
pcad04350  TGF-beta signaling pathway
pcad04371  Apelin signaling pathway
pcad04390  Hippo signaling pathway
pcad04520  Adherens junction
pcad04550  Signaling pathways regulating pluripotency of stem cells
pcad04659  Th17 cell differentiation
pcad04933  AGE-RAGE signaling pathway in diabetic complications
pcad05161  Hepatitis B
pcad05166  Human T-cell leukemia virus 1 infection
pcad05200  Pathways in cancer
pcad05210  Colorectal cancer
pcad05212  Pancreatic cancer
pcad05220  Chronic myeloid leukemia
pcad05225  Hepatocellular carcinoma
pcad05226  Gastric cancer
Brite
KEGG Orthology (KO) [BR:pcad00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04310 Wnt signaling pathway
    102986517 (SMAD4)
   04350 TGF-beta signaling pathway
    102986517 (SMAD4)
   04390 Hippo signaling pathway
    102986517 (SMAD4)
   04371 Apelin signaling pathway
    102986517 (SMAD4)
   04068 FoxO signaling pathway
    102986517 (SMAD4)
 09140 Cellular Processes
  09143 Cell growth and death
   04110 Cell cycle
    102986517 (SMAD4)
  09144 Cellular community - eukaryotes
   04520 Adherens junction
    102986517 (SMAD4)
   04550 Signaling pathways regulating pluripotency of stem cells
    102986517 (SMAD4)
 09150 Organismal Systems
  09151 Immune system
   04659 Th17 cell differentiation
    102986517 (SMAD4)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    102986517 (SMAD4)
  09162 Cancer: specific types
   05210 Colorectal cancer
    102986517 (SMAD4)
   05212 Pancreatic cancer
    102986517 (SMAD4)
   05225 Hepatocellular carcinoma
    102986517 (SMAD4)
   05226 Gastric cancer
    102986517 (SMAD4)
   05220 Chronic myeloid leukemia
    102986517 (SMAD4)
  09167 Endocrine and metabolic disease
   04933 AGE-RAGE signaling pathway in diabetic complications
    102986517 (SMAD4)
  09172 Infectious disease: viral
   05166 Human T-cell leukemia virus 1 infection
    102986517 (SMAD4)
   05161 Hepatitis B
    102986517 (SMAD4)
SSDB
Motif
Pfam: MH2 MH1 IRF-3
Other DBs
NCBI-GeneID: 102986517
NCBI-ProteinID: XP_007104597
UniProt: A0A2Y9EKH2
LinkDB
Position
19
AA seq 553 aa
MDNMSITNTPTSNDACLSIVHSLMCHRQGGESETFAKRAIESLVKKLKEKKDELDSLITA
ITTNGAHPSKCVTIQRTLDGRLQVAGRKGFPHVIYARLWRWPDLHKNELKHVKYCQYAFD
LKCDSVCVNPYHYERVVSPGIDLSGLTLQSNAPPSMLVKDEYVHDFEGQPSLSTEGHSIQ
TIQHPPSNRASTETYSTPALLAPSESNATSTTNFPNIPVASTSQPASILAGSHSEGLLQI
ASGPQPGQQQNGFTGQPATYHHNSTTTWTGSRTAPYTPNLPHHQNGHLQHHPPMPPHPGH
YWPPVHNELAFQPPISNHPAPEYWCSIAYFEMDVQVGETFKVPSSCPVVTVDGYVDPSGG
DRFCLGQLSNVHRTEAIERARLHIGKGVQLECKGEGDVWVRCLSDHAVFVQSYYLDREAG
RAPGDAVHKIYPSAYIKVFDLRQCHRQMQQQAATAQAAAAAQAAAVAGNIPGPGSVGGIA
PAISLSAAAGIGVDDLRRLCILRMSFVKGWGPDYPRQSIKETPCWIEIHLHRALQLLDEV
LHTMPIADPQPLD
NT seq 1662 nt   +upstreamnt  +downstreamnt
atggacaatatgtctattacgaatacaccaacaagtaatgatgcctgtctgagcattgta
catagtttgatgtgccatagacaaggtggagagagtgaaacatttgcaaaaagagcaatt
gaaagtttggtaaagaaactgaaggagaaaaaagatgaattggattctttaataacagct
ataactacaaatggagctcaccctagcaaatgtgttaccatacagagaacattggatgga
aggcttcaggtggctggtcggaaaggatttcctcatgtgatctatgcccgtctctggagg
tggcctgatcttcacaaaaacgaattaaaacatgttaaatattgtcagtatgcatttgac
ttaaaatgtgatagtgtctgtgtgaatccatatcactatgaacgagttgtatcacctgga
attgatctctcaggattaacactgcagagtaatgctccacctagtatgttggtgaaggat
gaatatgttcatgactttgagggacagccatcattatccactgaaggacattcaattcaa
accatccagcatccaccaagtaatcgtgcatcgacggagacctacagcaccccagctctc
ttagccccatctgagtctaacgctaccagcaccaccaactttcccaacattcctgtggct
tccacaagtcagcctgccagtatactggcaggcagccatagtgaaggattgttgcagata
gcttcagggcctcagccaggacagcagcagaatggatttactggtcagccagctacttac
catcataacagcactaccacctggactggaagtagaactgcaccatacacacctaatttg
cctcaccaccaaaacggccatcttcagcaccacccgcctatgccgccccatcccggacat
tactggccgccggttcacaatgagcttgcattccagcctcccatttctaaccatcctgct
cctgagtattggtgttccattgcttactttgaaatggatgttcaagtaggagagacgttt
aaggttccttcaagctgtcctgttgttactgttgatggttatgtagacccttctggagga
gatcgcttttgcttgggtcaactctccaatgtccacaggacagaagccattgagagagca
aggttgcacataggcaaaggtgtgcagttggaatgtaaaggtgaaggtgatgtttgggtc
aggtgccttagtgaccacgcagtctttgtacagagctactacttagacagagaagctggg
cgtgcacctggagacgctgttcataagatctacccaagtgcatatataaaggtctttgat
ttgcgtcagtgtcatcgtcagatgcagcaacaggcagctactgcacaagctgcagcagct
gcccaggcagcagccgtggcaggaaacatccctggccccggatcagtaggtggaatagcc
ccagctatcagtttgtcagctgctgctggaattggtgttgatgaccttcgtcgtttatgc
atactcaggatgagttttgtgaaaggctgggggcctgactacccaagacagagcatcaag
gaaacaccttgctggattgagattcacttacaccgggccctccagctcctagatgaagta
cttcacaccatgcctattgccgacccacagcctttagactga

DBGET integrated database retrieval system